DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: kay and si:ch211-59d15.4

Sequence 1:NP_001027577.2 Gene:kay FlyBaseID:FBgn0001297 Length:755 Species:Drosophila melanogaster
Sequence 2:XP_689915.3 Gene:si:ch211-59d15.4 ZFINID:ZDB-GENE-041014-37 Length:192 Species:Danio rerio

Alignment Length:263 Identity:63/264 (24%)
Similarity:91/264 (34%) Gaps:102/264 (39%)


  Fly   348 TDSTSYQAGHIMAGSVNGGGVNNFSNVLAAVSSSRG-SASVGSSNANTSNTPAR----------- 400
            ::.|.:..|.|             ||.::.|...|. |..:.:.||..|....|           
Zfish     4 SERTCFSEGEI-------------SNSISQVEMQRSKSPFIATVNAVASRQELRWIIEPVMQSES 55

  Fly   401 ----RGGGRRPNRSTNMTPEEEQKRAVRRERNKQAAARCRKRRVDQTNELTEEVEQLEKRGESMR 461
                :|       ...::.:||:||..||||||.|||:||.||.:.|:.|.||.|:|......::
Zfish    56 LDHSKG-------DAQLSLDEEEKRRRRRERNKMAAAKCRNRRKELTDLLQEESERLYMEQVGLQ 113

  Fly   462 KEIEVLTNSKNQLEYLLATHRATCQKIRSDMLSVVTCNGLIAPAGLLSAGSSGSGASSHHNHNSN 526
            |::..|...|.||:.|||:|.:.|...:|..|.                           |..|.
Zfish   114 KQVSSLQQEKEQLKMLLASHASICTLDKSISLD---------------------------NFQSK 151

  Fly   527 D--SSNGTITGMDATLNSTGRSNSPLDLKPAANIDSLLMHIKDEPLDG-------AIDSGSSLDQ 582
            |  .|...:|                              ||.|||||       .:.....|.:
Zfish   152 DILPSRTAVT------------------------------IKQEPLDGISMSRHFGLQQAVELTE 186

  Fly   583 DGP 585
            :||
Zfish   187 EGP 189

Known Domains:


GeneSequenceDomainRegion External IDIdentity
kayNP_001027577.2 bZIP_Fos 420..481 CDD:269869 29/61 (48%)
coiled coil 421..480 CDD:269869 28/59 (47%)
si:ch211-59d15.4XP_689915.3 bZIP 80..133 CDD:304365 23/53 (43%)
coiled coil 80..124 CDD:269834 18/44 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1414
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000603
OrthoInspector 1 1.000 T596392
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23351
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.