DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: kay and BATF3

Sequence 1:NP_001027577.2 Gene:kay FlyBaseID:FBgn0001297 Length:755 Species:Drosophila melanogaster
Sequence 2:XP_016857172.1 Gene:BATF3 HGNCID:28915 Length:138 Species:Homo sapiens

Alignment Length:106 Identity:28/107 (26%)
Similarity:52/107 (49%) Gaps:11/107 (10%)


  Fly   381 SRGSASVGSSNANTSNTPARRGGGRRPN-RSTNMTPEEEQKRAVRRERNKQAAARCRKRRVDQTN 444
            |:|..:.||....:...|     |.:|. :....:||::.::..|||:|:.||.|.||::..:.:
Human     2 SQGLPAAGSVLQRSVAAP-----GNQPQPQPQQQSPEDDDRKVRRREKNRVAAQRSRKKQTQKAD 61

  Fly   445 ELTEEVEQLEKRGESMRKEIEVLTNSKNQLEYLLATHRATC 485
            :|.|.:|:.......:|....:|::|     :.|..|..||
Human    62 KLHELMERTIFLITQIRSLGFILSHS-----FSLRPHAYTC 97

Known Domains:


GeneSequenceDomainRegion External IDIdentity
kayNP_001027577.2 bZIP_Fos 420..481 CDD:269869 16/61 (26%)
coiled coil 421..480 CDD:269869 16/59 (27%)
BATF3XP_016857172.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1414
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23351
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.