DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: kay and fos

Sequence 1:NP_001027577.2 Gene:kay FlyBaseID:FBgn0001297 Length:755 Species:Drosophila melanogaster
Sequence 2:NP_001016200.1 Gene:fos XenbaseID:XB-GENE-866811 Length:368 Species:Xenopus tropicalis

Alignment Length:394 Identity:103/395 (26%)
Similarity:159/395 (40%) Gaps:88/395 (22%)


  Fly   326 NASYNDTQMNEEQDTTDTSSAHTDSTSY----QAGHIMAGS------VNGGGVNNFSNVLAAVSS 380
            :|..:.|:.:.......::|...||.:|    .|.....||      ..|...::|...:.|:|:
 Frog     3 HAFSSSTEYDAASSRCSSASPAGDSLTYYPSPAASFSSMGSPVSPQDFGGDSSSSFVPTVTAIST 67

  Fly   381 SR-----------GSASVGSSNANT-SNTPA-------RRGGGR-----RPNRSTNMTPEEEQKR 421
            |.           .|.:...|.|:. .:|||       :...||     |..:...::||||:||
 Frog    68 SPDLQWLVQPTLISSVAPSQSRAHPYGSTPAYSRSSVMKGSAGRGQSLGRRGKMEQLSPEEEEKR 132

  Fly   422 AVRRERNKQAAARCRKRRVDQTNELTEEVEQLEKRGESMRKEIEVLTNSKNQLEYLLATHRATCQ 486
            .|||||||.|||:||.||.:.|:.|..|.:.||.:..:::.||..|...|.:||::||.|:..| 
 Frog   133 KVRRERNKMAAAKCRNRRRELTDTLQAETDDLEDQKSALQAEIAGLLKEKEKLEFILAAHKPAC- 196

  Fly   487 KIRSDMLSVVTCNGLIAPAGLLSAGSSGSGASSHHNHNSNDSSNGTITGMDATLNSTGRSNSPLD 551
            ||..|:.............||:|.....|            ||...:.   ..|...|.|.|.:.
 Frog   197 KIPHDLDGAFQDLTSSLDLGLISETPCSS------------SSQEPVA---EPLFPIGLSQSSMP 246

  Fly   552 LKPAANIDSLLMHIKDEPLDGAIDSGSSLDQDGPPPSKRITLPPMSTMPHVHLSTIL-------- 608
            .|....: .:.|.:|.||||..:.:.|   ..|...:.|       ::|.|.|::.|        
 Frog   247 EKENTQL-QVSMELKSEPLDDFLFNSS---HTGVTDAAR-------SVPDVDLTSSLYTSEWEPL 300

  Fly   609 -TPTGASSGSLQTPITSTAP------GGFGSAFPVTSN----------GSSINNINSIGNNMNSP 656
             :...|....|.||:.:..|      ..|...:|.:.:          |||.|..:|  :::|||
 Frog   301 YSTLSADMEPLCTPVVTCTPTCTTYTTSFVFTYPESDHFPNCGAAHRRGSSSNEQSS--DSLNSP 363

  Fly   657 TLNA 660
            ||.|
 Frog   364 TLLA 367

Known Domains:


GeneSequenceDomainRegion External IDIdentity
kayNP_001027577.2 bZIP_Fos 420..481 CDD:269869 29/61 (48%)
coiled coil 421..480 CDD:269869 28/59 (47%)
fosNP_001016200.1 bZIP_Fos 131..192 CDD:269869 29/61 (48%)
coiled coil 132..191 CDD:269869 28/59 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1414
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000603
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
32.860

Return to query results.
Submit another query.