DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: kay and fosb

Sequence 1:NP_001027577.2 Gene:kay FlyBaseID:FBgn0001297 Length:755 Species:Drosophila melanogaster
Sequence 2:XP_005173698.1 Gene:fosb ZFINID:ZDB-GENE-041114-181 Length:411 Species:Danio rerio

Alignment Length:441 Identity:106/442 (24%)
Similarity:161/442 (36%) Gaps:138/442 (31%)


  Fly   297 MGIPTGVSSL-PLQQTF--DLSLG-QGSESEDSNASYNDTQMNEEQDTTDTSSAHTDSTSYQAGH 357
            :|:...:.|: .:.|.|  |...| :||.|....:.|..:.  |...:..|:||..:..:...|.
Zfish    31 VGVSASLGSIGDMFQGFPGDPDTGSRGSSSPSLESQYLSSV--ESFGSPPTTSAPQECVTATGGV 93

  Fly   358 IMAGSVNGGGV---NNFSNVLAAVSSSR----------------GSASVGSSNAN---------- 393
            .:.|...|.||   ::|...:.|:::|:                |.:..|||...          
Zfish    94 GVGGGSTGAGVDMPSSFVPTVTAITTSQDLQWMVQPTLISSVAPGQSGTGSSTMTQPVALDPYDL 158

  Fly   394 -------------TSNT--PARRGGGRRPNRSTNMTPEEEQKRAVRRERNKQAAARCRKRRVDQT 443
                         :|:|  |.|:...||..|...:|||||:||.|||||||.|||:||.||.:.|
Zfish   159 PGPSFSSGGFTPPSSDTPGPVRQSRSRRRARDETLTPEEEEKRRVRRERNKLAAAKCRNRRRELT 223

  Fly   444 NELTEEVEQLEKRGESMRKEIEVLTNSKNQLEYLLATHRATCQKIRSDM--------------LS 494
            :.|..|.:.||:....:..||..|...|.:||::|..|:..|:....|.              :|
Zfish   224 DRLQSETDILEEEKAELEAEISELQKEKERLEFVLVAHQPGCKLPYQDQPPAPLPQTSPQAPSVS 288

  Fly   495 VVTCNGL--------IAPAGLLSAGSSGSGASSHHNHNSNDSSNGTITGMDATLNSTGRSNSPLD 551
            ||   ||        :.||           .||||:|:...|                   .|..
Zfish   289 VV---GLTVKEDSFYLPPA-----------YSSHHHHHVPVS-------------------QPTQ 320

  Fly   552 LKPAANIDSLLMHIKDEPLDGAIDSGSSLDQDGPPPSKRITLPPMSTMPHVHLSTILTPTGA--- 613
            .:||.......| :::.....:.........|||                     .|...|.   
Zfish   321 TQPAPAQQQQGM-MQEVAFSSSFYGPGQPAPDGP---------------------CLVADGGGNP 363

  Fly   614 SSGSLQTPITSTAPGGFGSAFPVTSNGSSINNINS----IGNNMNSPTLNA 660
            .:||.....||:    |...:|..:.|:|.|...|    ..:::|||:|.|
Zfish   364 DAGSYIPSYTSS----FVFTYPEGACGASANQRTSSSDQSSDSLNSPSLLA 410

Known Domains:


GeneSequenceDomainRegion External IDIdentity
kayNP_001027577.2 bZIP_Fos 420..481 CDD:269869 28/61 (46%)
coiled coil 421..480 CDD:269869 27/59 (46%)
fosbXP_005173698.1 bZIP_Fos 208..261 CDD:269869 21/53 (40%)
coiled coil 208..260 CDD:269869 21/52 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1414
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23351
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.