DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: kay and Atf3

Sequence 1:NP_001027577.2 Gene:kay FlyBaseID:FBgn0001297 Length:755 Species:Drosophila melanogaster
Sequence 2:NP_001259125.1 Gene:Atf3 FlyBaseID:FBgn0028550 Length:688 Species:Drosophila melanogaster

Alignment Length:711 Identity:139/712 (20%)
Similarity:226/712 (32%) Gaps:267/712 (38%)


  Fly   162 GWNPETPG--QAQLALTATTCNTTAAATCNTTAAATTSTTATSAAAGSDNNHSDNFAMDASEIAT 224
            |..|:||.  .:.:|:|....|.:.::.....||.:.::::.|.:|.|                 
  Fly    23 GHTPKTPEILNSLIAMTNPLENFSYSSAAAAAAAVSVASSSASCSAAS----------------- 70

  Fly   225 FLANELFLQQLGNFETGQSVLTLTTPTLT-------PTTTRNIEDTLGHLLSDTQTDRVAGCAGF 282
                                    ||.:|       |....:.:|:.....|.:..|..||.|  
  Fly    71 ------------------------TPVVTVRHFNGHPNGQSHSQDSSHSSCSGSPLDSPAGTA-- 109

  Fly   283 AVPKVLPNAIDVLGMGIPTGVSSLPLQQTFDLSLGQGSESEDSNASYNDTQMNEEQDTTDTSSAH 347
            ..|.|......::..|:...:.|.....|.|.|.|    ||..::.|:....|..          
  Fly   110 TTPSVQQTCSRLIKEGLKLSIQSKRKLSTCDSSSG----SEQPHSKYSRRSSNHN---------- 160

  Fly   348 TDSTSYQAGHIMAGSVNGGGVNNFSNVLAAVSSSRGSASVGSSNANTSNTPARRGG---GRRPNR 409
                    ||       .|..||:|..:              ||||..:.......   ....::
  Fly   161 --------GH-------SGSSNNYSGSM--------------SNANDLDDDCEESSDDDSETKSQ 196

  Fly   410 STNMTPEEEQKRAVRRERNKQAAARCRKRRVDQTNELTEEVEQLEKRGESMRKEIEVLTNSKNQL 474
            ...:|||:|.:|..||||||.||.:||.::.::|..|.:|.|.|:.:...::.::..|...:.:|
  Fly   197 PKGLTPEDEDRRRRRRERNKIAATKCRMKKRERTQNLIKESEVLDTQNVELKNQVRQLETERQKL 261

  Fly   475 EYLLATH---------------RATCQKIRSDM-LSVVTCNG----------------------- 500
            ..:|.:|               ::..||..|:: |..|:.:|                       
  Fly   262 VDMLKSHGCQRAGGCQLPSQLLQSPAQKYLSELELETVSIDGPNSGNNNQRLQSIPSMATFKYGS 326

  Fly   501 ------------------------------------------LIAPAG--------------LLS 509
                                                      .:.|||              |||
  Fly   327 KTAAAMAQQLPNGYCKPSPSAQEFEHAGYQQQQQQQQQQQPQSLNPAGNNVIDQQHANPSPSLLS 391

  Fly   510 ------AGSSGSGASSHHNHNSNDSSNGTITGMDATLN-----STGRSNSPLDLKPAANIDSLLM 563
                  .|.:|| ||:|.:||:|:::|.:......|.|     |:..||:.....|.|. .|.:.
  Fly   392 DYVPNCDGLTGS-ASNHPSHNNNNNNNNSSGASSNTSNNNSNISSHSSNATSSTTPTAT-SSAIE 454

  Fly   564 HIKDEPLDGAIDSGSSLDQDGPPPSKRITLPPMSTMPHV-HLSTILTPTGASSGSLQTPITSTAP 627
            .:|:|.:|......::|.      ::|....|....|.: |...:.:|.|.:             
  Fly   455 FVKNELVDSQSPYTTALS------AERFLFEPSDGFPDIKHACVLPSPCGIN------------- 500

  Fly   628 GGFGSAFPVTSNGSSINNINSIGNNMNSPTLNAHNKVPKERPNTLAFQRPLGQMHLTMANNKAGG 692
             |...|..|.:|||:.||.||..||.|:.  |.|                |...|..:.:...|.
  Fly   501 -GLNMASVVNTNGSTGNNNNSHHNNNNNN--NNH----------------LMDFHQGLQHGNIGT 546

  Fly   693 PTQI---------QGVPIQTP---------STGTFNFDSLMDGGTGLTPVSGPLVPNSSST 735
            ...:         .||.:.||         ..|.|..|.|    :.|....|..|...|:|
  Fly   547 GVGVGVGVGVGVGVGVGVMTPYDDEQLLLLKNGCFATDLL----SQLVEEGGEYVDLDSAT 603

Known Domains:


GeneSequenceDomainRegion External IDIdentity
kayNP_001027577.2 bZIP_Fos 420..481 CDD:269869 19/61 (31%)
coiled coil 421..480 CDD:269869 19/59 (32%)
Atf3NP_001259125.1 bZIP_ATF3 215..268 CDD:269870 14/53 (26%)
coiled coil 215..265 CDD:269870 13/50 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1414
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR23351
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.