DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: kay and FOSB

Sequence 1:NP_001027577.2 Gene:kay FlyBaseID:FBgn0001297 Length:755 Species:Drosophila melanogaster
Sequence 2:NP_006723.2 Gene:FOSB HGNCID:3797 Length:338 Species:Homo sapiens

Alignment Length:223 Identity:73/224 (33%)
Similarity:98/224 (44%) Gaps:58/224 (26%)


  Fly   279 CAGFA------VPKV--LPNAIDVLGMGIPTGVSSLPLQQTFDLSLGQGSESEDSNASYNDTQMN 335
            |||..      ||.|  :..:.|:..:..||.:||:...|      ||...|:.......|    
Human    44 CAGLGEMPGSFVPTVTAITTSQDLQWLVQPTLISSMAQSQ------GQPLASQPPVVDPYD---- 98

  Fly   336 EEQDTTDTSSAHTDSTSYQAGHIMAGSVNGGGVNNFSNVLAAVSSSRGSASVGSSNANTSNT--- 397
                        ...|||..          .|::.:|:         |.|| ||...:||.|   
Human    99 ------------MPGTSYST----------PGMSGYSS---------GGAS-GSGGPSTSGTTSG 131

  Fly   398 --PAR--RGGGRRPNRSTNMTPEEEQKRAVRRERNKQAAARCRKRRVDQTNELTEEVEQLEKRGE 458
              |||  |...|||...| :|||||:||.|||||||.|||:||.||.:.|:.|..|.:|||:...
Human   132 PGPARPARARPRRPREET-LTPEEEEKRRVRRERNKLAAAKCRNRRRELTDRLQAETDQLEEEKA 195

  Fly   459 SMRKEIEVLTNSKNQLEYLLATHRATCQ 486
            .:..||..|...|.:||::|..|:..|:
Human   196 ELESEIAELQKEKERLEFVLVAHKPGCK 223

Known Domains:


GeneSequenceDomainRegion External IDIdentity
kayNP_001027577.2 bZIP_Fos 420..481 CDD:269869 29/61 (48%)
coiled coil 421..480 CDD:269869 28/59 (47%)
FOSBNP_006723.2 Basic motif. {ECO:0000255|PROSITE-ProRule:PRU00978} 157..182 17/25 (68%)
bZIP_Fos 165..218 CDD:269869 22/53 (42%)
coiled coil 165..217 CDD:269869 22/52 (42%)
Leucine-zipper. {ECO:0000255|PROSITE-ProRule:PRU00978} 183..211 9/28 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1414
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T608829
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23351
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.