DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: kay and zip-11

Sequence 1:NP_001027577.2 Gene:kay FlyBaseID:FBgn0001297 Length:755 Species:Drosophila melanogaster
Sequence 2:NP_500318.1 Gene:zip-11 WormBaseID:WBGene00021082 Length:228 Species:Caenorhabditis elegans

Alignment Length:46 Identity:13/47 (28%)
Similarity:29/47 (62%) Gaps:0/47 (0%)


  Fly   416 EEEQKRAVRRERNKQAAARCRKRRVDQTNELTEEVEQLEKRGESMR 461
            :|.:..:.:|::||.||||.|.::..:..:|.:::|..|.|.:.::
 Worm   159 DETKLLSRKRQQNKVAAARYRDKQKAKWQDLLDQLEAEEDRNQRLK 204

Known Domains:


GeneSequenceDomainRegion External IDIdentity
kayNP_001027577.2 bZIP_Fos 420..481 CDD:269869 12/43 (28%)
coiled coil 421..480 CDD:269869 12/42 (29%)
zip-11NP_500318.1 bZIP_ATF4 166..224 CDD:269840 12/40 (30%)
coiled coil 166..223 CDD:269840 12/40 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR23351
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.