DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: kay and creb5

Sequence 1:NP_001027577.2 Gene:kay FlyBaseID:FBgn0001297 Length:755 Species:Drosophila melanogaster
Sequence 2:XP_002933437.2 Gene:creb5 XenbaseID:XB-GENE-950883 Length:501 Species:Xenopus tropicalis

Alignment Length:460 Identity:104/461 (23%)
Similarity:156/461 (34%) Gaps:157/461 (34%)


  Fly   197 STTATSAAAGSDN------------NHSDNFAMDASEIATFLANELFLQQLGNFETGQSVLTLTT 249
            |.|..:||.|...            ||      |.|.:         :||........||:    
 Frog    91 SITMHNAAGGMTGPGTHQLSNPRLPNH------DTSVV---------IQQAMPSPQSSSVI---- 136

  Fly   250 PTLTPTTTRNIEDTLGHL-----LSDTQTDRVAGCAGFAVPKVLPNAIDVLGMGIPT--GVSS-- 305
             |..|:|.|.|....|.|     |.:.|...:..    ::|..|||         ||  |.|:  
 Frog   137 -TQAPSTNRQIGPVPGSLSSLLHLHNRQRQPMPA----SMPGTLPN---------PTMPGSSAVL 187

  Fly   306 LPLQQTFDLS---LG-QG----------------SESE-------------DSNASYND-----T 332
            :|:::...:|   :| ||                ||::             .||.:.|.     .
 Frog   188 MPMERQMSMSSNIMGMQGPNINNPCASPQVPPMHSEAKMRLKAALSHHPGAISNGNMNSMGHMID 252

  Fly   333 QMNEEQDTTDTSSAHTDSTSYQA------------------GHIMAGSVNGGGVNNFSNVLAAVS 379
            .||..||.|.....|:....:|:                  .|.......|...::..:.|.|..
 Frog   253 MMNSRQDQTPHHHMHSHPHQHQSLPQHHPYPHQQHQHPPHHPHSQPHHQQGHPHHHSHSHLHAHP 317

  Fly   380 S-----------SRGSASVGSSNANTSNT----PARRGGGRRPNRSTNMTPEEEQKRAVRRERNK 429
            |           :.|.|.:..:......|    |.:..|||| .|..:..|:|.:::.:  |||:
 Frog   318 SHHQTSPHPPLHTGGQAQLSPAAQQMQPTQTIQPQQPTGGRR-RRVVDEDPDERRRKFL--ERNR 379

  Fly   430 QAAARCRKRRVDQTNELTEEVEQLEKRGESMRKEIEVLTNSKNQLEYLLATHR----ATCQKIRS 490
            .||.|||::|......|.::.|:|.:....::.|:.:|.|...||:.||.||:    ...||   
 Frog   380 AAATRCRQKRKVWVMSLEKKAEELTQTNMQLQNEVSMLKNEVAQLKQLLLTHKDCPITAMQK--- 441

  Fly   491 DMLSVVTCNGLIAPAGLLSAGSSGSGASSHH---NHNSNDSSNGTITGMDATLNSTGRSNSPLDL 552
                  ...|.::|..  |...|...|.|..   .||       |||...:..:..|.||    |
 Frog   442 ------ESQGYLSPEN--SPPESPVPACSQQQVIQHN-------TITTSSSVSDVVGSSN----L 487

  Fly   553 KPAAN 557
            .|.||
 Frog   488 NPLAN 492

Known Domains:


GeneSequenceDomainRegion External IDIdentity
kayNP_001027577.2 bZIP_Fos 420..481 CDD:269869 20/61 (33%)
coiled coil 421..480 CDD:269869 19/59 (32%)
creb5XP_002933437.2 bZIP_ATF2 370..429 CDD:269835 19/61 (31%)
coiled coil 370..429 CDD:269835 19/61 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1414
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.