DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: kay and atf3

Sequence 1:NP_001027577.2 Gene:kay FlyBaseID:FBgn0001297 Length:755 Species:Drosophila melanogaster
Sequence 2:XP_002934744.1 Gene:atf3 XenbaseID:XB-GENE-6085251 Length:181 Species:Xenopus tropicalis

Alignment Length:75 Identity:33/76 (43%)
Similarity:47/76 (62%) Gaps:0/76 (0%)


  Fly   411 TNMTPEEEQKRAVRRERNKQAAARCRKRRVDQTNELTEEVEQLEKRGESMRKEIEVLTNSKNQLE 475
            |...|||:.::..||||||.|||:||.::.::|..|.:|.|:||.....::.:||.|.|.|..|.
 Frog    79 TEFVPEEDDRKKRRRERNKVAAAKCRNKKKEKTESLQKESEKLESINADLKAQIEELKNEKQHLI 143

  Fly   476 YLLATHRATC 485
            |:|..||.||
 Frog   144 YMLNLHRPTC 153

Known Domains:


GeneSequenceDomainRegion External IDIdentity
kayNP_001027577.2 bZIP_Fos 420..481 CDD:269869 25/61 (41%)
coiled coil 421..480 CDD:269869 25/59 (42%)
atf3XP_002934744.1 bZIP_ATF3 96..149 CDD:269870 21/53 (40%)
coiled coil 96..146 CDD:269870 20/50 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1414
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.