DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: kay and fosb

Sequence 1:NP_001027577.2 Gene:kay FlyBaseID:FBgn0001297 Length:755 Species:Drosophila melanogaster
Sequence 2:XP_002932681.2 Gene:fosb XenbaseID:XB-GENE-6258697 Length:297 Species:Xenopus tropicalis

Alignment Length:383 Identity:86/384 (22%)
Similarity:129/384 (34%) Gaps:149/384 (39%)


  Fly   338 QDTTDTSSAHTDSTSYQAGHIMAGSVNGGGV-----------NNFSNVLAAVSSSRGSASV---- 387
            |....:||:.:..:.|.:.....||....|:           .:|...:.|::||:....:    
 Frog     3 QGYDSSSSSPSAESQYLSSVDSFGSPQAAGIPQECAALCDAPTSFVPTVTAITSSQDLQWLVTPA 67

  Fly   388 ----------------------GSSNANTSNT-----------------PARRGGGRRPNRSTNM 413
                                  |.|.|:.|.|                 |: |..|:|......:
 Frog    68 LISSMAQSQPTSGPPIDPYDLPGPSYASPSGTTYGHTLTEAAPEQEEVRPS-RARGKRTREEAAL 131

  Fly   414 TPEEEQKRAVRRERNKQAAARCRKRRVDQTNELTEEVEQLEKRGESMRKEIEVLTNSKNQLEYLL 478
            |||||:||.|||||||.|||:||.||.:.|:.|..|.:.||:...::..||:.|...|.|||:.|
 Frog   132 TPEEEEKRRVRRERNKLAAAKCRNRRRELTDRLQSETDILEEEKSTLEAEIDELRRQKEQLEFAL 196

  Fly   479 ATHRATCQKIRSDMLSVVTCNGLIAPAGLLSAGSSGSGASSHHNHNSNDSSNGTITGMDATLNST 543
            .:||..| |:..|.:.:.|                 :..|:.:.|                    
 Frog   197 LSHRPGC-KLPYDDIDLPT-----------------TDPSTSYPH-------------------- 223

  Fly   544 GRSNSPLDLKPAANIDSLLMHIKDEPLDGAIDSGSSLDQDGPPPSKRITLPPMSTMPHVHLSTIL 608
                                        ||:                  ||...|.|.|.....|
 Frog   224 ----------------------------GAL------------------LPTYPTQPEVSFPICL 242

  Fly   609 -----TPTGASSGSLQTPITSTAP-GGFGSAFPVTSNGSSINNINSIGNNMNSPTLNA 660
                 :....|.||..:....|:| ||...|....|:||.    .|..::::||:|.|
 Frog   243 PSLPDSDCATSVGSYTSSFVFTSPEGGACGARYQRSSGSE----RSSSDSLSSPSLLA 296

Known Domains:


GeneSequenceDomainRegion External IDIdentity
kayNP_001027577.2 bZIP_Fos 420..481 CDD:269869 29/61 (48%)
coiled coil 421..480 CDD:269869 28/59 (47%)
fosbXP_002932681.2 bZIP_Fos 146..199 CDD:269869 22/53 (42%)
coiled coil 146..198 CDD:269869 22/52 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1414
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T600738
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
32.860

Return to query results.
Submit another query.