DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: kay and atf2

Sequence 1:NP_001027577.2 Gene:kay FlyBaseID:FBgn0001297 Length:755 Species:Drosophila melanogaster
Sequence 2:XP_017953047.1 Gene:atf2 XenbaseID:XB-GENE-961088 Length:517 Species:Xenopus tropicalis

Alignment Length:447 Identity:98/448 (22%)
Similarity:163/448 (36%) Gaps:119/448 (27%)


  Fly   192 AAATTSTTATSAAAGSDNNHSDNFAMDASEIATFLANELFLQQLGNFETGQSVLTLTTPTLTPTT 256
            ||..|||....|:....|           .:.|...:.:.:|......|..:|:|...|...|..
 Frog   137 AAQPTSTIVRPASLQVPN-----------VLLTNTDSSVIIQPAIPSPTSSTVITQAPPASRPIV 190

  Fly   257 TRNIEDTLGHLLSDTQTDRVAGCAGF---------AVPKVLPNAIDVLGMGIPTGVSSLPLQQTF 312
            .......|...|.:.||..||..|..         :||.|.|..:.....|||...|..|:|   
 Frog   191 PVPAPFPLLLHLPNGQTMPVAIPASITNSNVHIPASVPLVRPVTVVPTIPGIPGPASPQPVQ--- 252

  Fly   313 DLSLGQGSESEDSNASYNDTQMNEEQDTTDTSSAHTDSTSYQAGHIMAGSVNGGGVNNFSNVLAA 377
                   ||::...:||  :.:.:.::|.               |:...|...|.......:.||
 Frog   253 -------SEAKLQPSSY--SYLQKRKNTC---------------HVSKKSERNGLKGERKRLKAA 293

  Fly   378 VSS------SRGSASVGSSN-------------------ANTSNTPA---------RRGGGRRPN 408
            ::.      :.|.|:.|..:                   .:|:.|||         :..|||| .
 Frog   294 LTQQQNPQVTNGDATKGQGSGTAKSQPEEAQPHSLQQPATSTTETPASPVPPAPQTQSTGGRR-R 357

  Fly   409 RSTNMTPEEEQKRAVRRERNKQAAARCRKRRVDQTNELTEEVEQLEKRGESMRKEIEVLTNSKNQ 473
            ::.:..|:|::::.:  |||:.||:|||::|......|.::.|.|......::.|:.:|.|...|
 Frog   358 KAASDDPDEKRRKFL--ERNRAAASRCRQKRKVWVQSLEKKAEDLSSFNVQLQNEVTLLRNEVAQ 420

  Fly   474 LEYLLATHRATCQKIRSDMLSVVTCNGLIAPAGLLSAGSSGSGASSHHN----HNSNDSSNGTIT 534
            |:.||..|: .|.                     ::|....||   :||    .:|.|.|..:..
 Frog   421 LKQLLLAHK-DCP---------------------VTAMQKKSG---YHNAEKDESSEDLSVPSSP 460

  Fly   535 GMDATLNST-GRSNSPLDLKPAANI-DSLLMHIKDEPLDGAIDSGSSLDQDGPPPSK 589
            .|:|..:|: ..||.......|..| .|:|..:.|:..:.|:    |.....|||::
 Frog   461 QMEAIQHSSVSTSNGVSSTSMAEAIATSVLSQMADQSTEPAV----SQVVMAPPPAQ 513

Known Domains:


GeneSequenceDomainRegion External IDIdentity
kayNP_001027577.2 bZIP_Fos 420..481 CDD:269869 19/61 (31%)
coiled coil 421..480 CDD:269869 19/59 (32%)
atf2XP_017953047.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1414
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.