DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: kay and fosl1

Sequence 1:NP_001027577.2 Gene:kay FlyBaseID:FBgn0001297 Length:755 Species:Drosophila melanogaster
Sequence 2:XP_002939377.2 Gene:fosl1 XenbaseID:XB-GENE-6257957 Length:298 Species:Xenopus tropicalis

Alignment Length:317 Identity:81/318 (25%)
Similarity:110/318 (35%) Gaps:123/318 (39%)


  Fly   338 QDTTDTSSAHTDSTSYQAGHIMAGSVNGGGVNNFSNVLAAVSSSRG-----SASVGSSNANTSNT 397
            :|.......||.|                  ..|...|.|::||:.     ..||...|.....:
 Frog    46 EDAQQKYPVHTSS------------------GQFIPTLNAITSSQDLNWMIQPSVRPLNLPPYQS 92

  Fly   398 P-----ARRGG----GRRPNRSTNMTPEEEQKRAVRRERNKQAAARCRKRRVDQTNELTEEVEQL 453
            |     ...||    |||.| ..:::||||::|.|||||||.|||:||.||.:.|:.|..|.::|
 Frog    93 PRHGVIRNMGGVLSMGRRRN-GEHLSPEEEERRRVRRERNKVAAAKCRNRRKELTDYLQAETDKL 156

  Fly   454 EKRGESMRKEIEVLTNSKNQLEYLLATHRATCQKIRSDMLSVVTCNGLIAPAGLLSAGSSGSGAS 518
            |:...|::|||..|...|::||.:|..|:..|:                             ...
 Frog   157 EEEKSSLQKEIAELQKQKDKLELILEAHQPICK-----------------------------FPD 192

  Fly   519 SHHNHNSNDSSNGTITGMDATLNSTGRSNSPLDLKPAANIDSLLMHIKDEPLDGAIDSGSSLDQD 583
            ||||....|||.                                 .:|.||           .::
 Frog   193 SHHNMQQVDSSR---------------------------------LVKKEP-----------HEE 213

  Fly   584 GPPPSKRITLPPMSTMPHVHLS-TILTPTGASSGSLQTPITSTAPGGFGSAFPVTSN 639
            .|       ..|...:|.:.|| |||.|.     :|.||.....|    |..|.|.|
 Frog   214 SP-------RGPKVNLPRIELSDTILEPE-----ALHTPTLMKTP----SITPFTPN 254

Known Domains:


GeneSequenceDomainRegion External IDIdentity
kayNP_001027577.2 bZIP_Fos 420..481 CDD:269869 29/61 (48%)
coiled coil 421..480 CDD:269869 29/59 (49%)
fosl1XP_002939377.2 bZIP_Fos 131..184 CDD:269869 23/53 (43%)
coiled coil 131..183 CDD:269869 23/52 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1414
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000603
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
32.860

Return to query results.
Submit another query.