DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: kay and atf2

Sequence 1:NP_001027577.2 Gene:kay FlyBaseID:FBgn0001297 Length:755 Species:Drosophila melanogaster
Sequence 2:XP_009302699.1 Gene:atf2 ZFINID:ZDB-GENE-030911-8 Length:488 Species:Danio rerio

Alignment Length:365 Identity:83/366 (23%)
Similarity:132/366 (36%) Gaps:106/366 (29%)


  Fly   226 LANE---LFLQQLGNFETGQSVLTLTTPTLTPTTTRNIEDTLGHL-----LSDTQTDRVAGCAGF 282
            |||.   :.:||.....|..||:     |..|:::|.|....|..     |.:.||..||..|..
Zfish   157 LANSEAGVVIQQALPSPTSSSVI-----THVPSSSRPIVPVSGTFPVLLQLPNGQTMPVAIPATI 216

  Fly   283 AVPKV-LPNAIDVLG--------MGIPTGVSSLPLQQTFDLSL-------------GQGSESEDS 325
            |...| :|.||.::.        .|||...|..|:|....:.|             |...:.:.|
Zfish   217 ASSSVHIPTAIPLVRPVTVVPSVPGIPGPASPQPVQSEAKMKLKAALSQQIPQVTNGDAIDIQSS 281

  Fly   326 NASYNDTQM---NEEQDTTDTSSAHTDSTSYQAGHIMAGSVNGGGVNNFSNVLAAVSSSRGSASV 387
            :||......   .|||.........|.:|....                                
Zfish   282 SASETPPPAPPPAEEQRPKSLQQPATSTTEIPV-------------------------------- 314

  Fly   388 GSSNANTSNTPARRGGGRRPNRSTNMTPEEEQKRAVRRERNKQAAARCRKRRVDQTNELTEEVEQ 452
             |......:||:.  |||| .|:|:..|:|::::.:  |||:.||:|||::|......|.::.|.
Zfish   315 -SPAPPAQHTPST--GGRR-RRTTSEDPDEKRRKFL--ERNRAAASRCRQKRKVWVQSLEKKAED 373

  Fly   453 LEKRGESMRKEIEVLTNSKNQLEYLLATHR----------------------------ATCQKIR 489
            |......::.|:.:|.|...||:.||..|:                            ::.|...
Zfish   374 LSSVNGQLQNEVTLLRNEVAQLKQLLLAHKDCPVTLLQKKSGYQPLDKEDSCGEMSVPSSPQNEA 438

  Fly   490 SDMLSVVTCNGLIA--PAGLLSAGSSGSGASSHHNHNSND 527
            ....|:.|.||:.:  .|.:|:|.|..:||::..:....|
Zfish   439 IQHSSISTSNGVSSSTAASVLTASSPAAGAAAEPSTEDED 478

Known Domains:


GeneSequenceDomainRegion External IDIdentity
kayNP_001027577.2 bZIP_Fos 420..481 CDD:269869 19/61 (31%)
coiled coil 421..480 CDD:269869 19/59 (32%)
atf2XP_009302699.1 C2H2 Zn finger 9..31 CDD:275370
GCN4_cent 47..84 CDD:213399
bZIP_ATF2 341..401 CDD:269835 19/62 (31%)
coiled coil 341..401 CDD:269835 19/62 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1414
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R103
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.