powered by:
Protein Alignment CG33688 and CG12849
DIOPT Version :9
| Sequence 1: | NP_001027131.1 |
Gene: | CG33688 / 3772065 |
FlyBaseID: | FBgn0053688 |
Length: | 175 |
Species: | Drosophila melanogaster |
| Sequence 2: | NP_611969.2 |
Gene: | CG12849 / 37971 |
FlyBaseID: | FBgn0035068 |
Length: | 172 |
Species: | Drosophila melanogaster |
| Alignment Length: | 168 |
Identity: | 50/168 - (29%) |
| Similarity: | 84/168 - (50%) |
Gaps: | 4/168 - (2%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 7 ILIILGYLATVFNHVTFTNLKCGIRGEKIYYFEKCFIKAVNRTHKYIDIYVNLHQQVVNNV-TVI 70
:||.:..:| :..|..|.|:.|.:|......||.|::|:||||:||:.:...:.:..|:|. |..
Fly 8 LLIFMSPMA-IRGHFEFNNVVCLVRDRMFMDFEYCYLKSVNRTYKYLSLKTKMFRLPVDNCETRF 71
Fly 71 KLMRHNNGYKPFFVDVTIDVCKFLKDPRQSIIKKLYDIYKNNSNINHTCPYKDVVIVHHLWTGNL 135
:|....|....:..|..:|.|||::|.:..|...:|..:...||:||||||...:::..|...:|
Fly 72 QLRMRENRRVLYNFDFKVDSCKFMRDRKHVIANWVYQTFGPYSNLNHTCPYDHDIVLDKLPVQHL 136
Fly 136 ESDFMKYLPLIDGDYAIYTEWSVYNVARAFIDVYIRVS 173
.......:| ||.|.:.:.|.|..:.|..:.:|...|
Fly 137 NKLVQSIIP--DGRYMMNSTWMVAGIPRTDVILYFTKS 172
|
Known Domains:
Indicated by green bases in alignment.
| Gene | Sequence | Domain | Region |
External ID | Identity |
| CG33688 | NP_001027131.1 |
DUF1091 |
72..152 |
CDD:284008 |
24/79 (30%) |
| CG12849 | NP_611969.2 |
DM8 |
80..172 |
CDD:214778 |
26/93 (28%) |
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Compara |
0 | 0.000 |
Not matched by this tool. |
| Domainoid |
1 |
1.000 |
52 |
1.000 |
Domainoid score |
I18610 |
| eggNOG |
1 |
0.900 |
- |
- |
|
E1_2FJG4 |
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
0 | 0.000 |
Not matched by this tool. |
| Isobase |
0 | 0.000 |
Not matched by this tool. |
| OMA |
0 | 0.000 |
Not matched by this tool. |
| OrthoDB |
0 | 0.000 |
Not matched by this tool. |
| OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000262 |
| OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
| orthoMCL |
0 | 0.000 |
Not matched by this tool. |
| Panther |
1 |
1.100 |
- |
- |
P |
PTHR20898 |
| Phylome |
1 |
0.910 |
- |
- |
|
|
| RoundUp |
0 | 0.000 |
Not matched by this tool. |
| SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
5 | 4.910 |
|
Return to query results.
Submit another query.