DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33688 and CG33690

DIOPT Version :8

Sequence 1:NP_001027131.1 Gene:CG33688 / 3772065 FlyBaseID:FBgn0053688 Length:175 Species:Drosophila melanogaster
Sequence 2:NP_001027133.1 Gene:CG33690 / 3772513 FlyBaseID:FBgn0053690 Length:170 Species:Drosophila melanogaster

Alignment Length:174 Identity:71/175 (41%)
Similarity:102/175 (58%) Gaps:5/175 (3%)


  Fly     1 MRVFFLILIILGYLATVFNHVTFTNLKCGIRGEKIYYFEKCFIKAVNRTHKYIDIYVNLHQQVVN 65
            |..:.|:..:|......|.|||||||.|.........|..|.|||||||||||.||..|     |
  Fly     1 MSKWLLVKFLLTLPMICFCHVTFTNLNCSSYNLDFMSFPTCRIKAVNRTHKYISIYAKL-----N 60

  Fly    66 NVTVIKLMRHNNGYKPFFVDVTIDVCKFLKDPRQSIIKKLYDIYKNNSNINHTCPYKDVVIVHHL 130
            .|.::.........|||..|::.|.|||:|..:..::|..|..::.|:||||||||...:||..|
  Fly    61 QVPIVDARVSFGQIKPFLYDLSYDGCKFMKTQKNVLVKTFYRTFQRNTNINHTCPYDHDLIVDKL 125

  Fly   131 WTGNLESDFMKYLPLIDGDYAIYTEWSVYNVARAFIDVYIRVSN 174
            :|||||.:|.:::.:.:|||||||:|:...::||.:.:|:::.|
  Fly   126 FTGNLEEEFGRFIIIPNGDYAIYTDWATNKISRASVKIYLKILN 169

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33688NP_001027131.1 DUF1091 72..152 CDD:284008 33/80 (41%)
CG33690NP_001027133.1 DUF1091 68..147 CDD:284008 33/79 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2FJG4
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.