DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33688 and CG33679

DIOPT Version :9

Sequence 1:NP_001027131.1 Gene:CG33688 / 3772065 FlyBaseID:FBgn0053688 Length:175 Species:Drosophila melanogaster
Sequence 2:NP_001027273.1 Gene:CG33679 / 3772494 FlyBaseID:FBgn0053679 Length:173 Species:Drosophila melanogaster


Alignment Length:171 Identity:51/171 - (29%)
Similarity:80/171 - (46%) Gaps:21/171 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 FLILIILGYLATVFNHVTFTNLKCGIRGEKIYYFEKCFIKAVNRTHKYIDIYVNL-----HQQVV 64
            :|:.|.|.::.....:|..|||||....:....|.:|.:|.:.|.....:|:|.|     ::.||
  Fly     3 YLLWISLLFIGESHGYVRLTNLKCESYDKSFVVFPECRLKVLGRGIIGANIHVKLLKLPINRMVV 67

  Fly    65 NNVTVIKLMRHNNGYKPFFVDVTIDVCKFLKDP-RQSIIKKLYDIYKNNSNINHTCPYKDVVIVH 128
            ..:|..||    |||.||..:|:.:.|:.|:.| |..:....|..:...|||||||||.|.:.:.
  Fly    68 RFITYRKL----NGYHPFLFNVSEEHCRVLRYPNRLRVFYYFYTAFMPFSNINHTCPYNDDIYIR 128

  Fly   129 HLWTGNLESDFMKYLPLIDGDYAIYTE-------W-SVYNV 161
            :.   .|:......:||..|.|.:..|       | |:.|:
  Fly   129 NC---TLDDRMFAKVPLPKGSYKLTLEMDDGVVNWISIINI 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33688NP_001027131.1 DUF1091 72..152 CDD:284008 27/80 (34%)
CG33679NP_001027273.1 DUF1091 70..149 CDD:284008 29/85 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.