DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33688 and CG33922

DIOPT Version :10

Sequence 1:NP_001027131.1 Gene:CG33688 / 3772065 FlyBaseID:FBgn0053688 Length:175 Species:Drosophila melanogaster
Sequence 2:NP_001027217.1 Gene:CG33922 / 3771945 FlyBaseID:FBgn0053922 Length:178 Species:Drosophila melanogaster


Alignment Length:166 Identity:59/166 - (35%)
Similarity:93/166 - (56%) Gaps:2/166 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IILGYLATVFNHVTFTNLKCGIRGEKIYYFEKCFIKAVNRTHKYIDIYVNLHQQVVNNVTV-IKL 72
            |.|..:..|...:.|||:||.....:...|..||:|:||||:||..:.|.|.:..|:||.: |..
  Fly    12 IFLFTIHLVICKLEFTNIKCVTLDPEFAVFHYCFLKSVNRTYKYYSLKVKLLKTPVSNVKINIAT 76

  Fly    73 MRHNNGYKPFFVDVTIDVCKFLKDPRQS-IIKKLYDIYKNNSNINHTCPYKDVVIVHHLWTGNLE 136
            .:..||||||..:||:|.|:|.|..|.: :....::.:|:.|||||:|||...:|:..:...:..
  Fly    77 FQRLNGYKPFLYNVTVDGCRFYKHQRSNPVFSYFFNFFKDYSNINHSCPYDHDIILDKVSISHAN 141

  Fly   137 SDFMKYLPLIDGDYAIYTEWSVYNVARAFIDVYIRV 172
            :.....||:..|:|....:|..||:.||.:|||.::
  Fly   142 TQVTNVLPVPHGNYLYRADWYAYNIKRATVDVYAKI 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33688NP_001027131.1 DUF1091 72..152 CDD:461928 27/80 (34%)
CG33922NP_001027217.1 DUF1091 72..156 CDD:461928 27/83 (33%)

Return to query results.
Submit another query.