DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33688 and CG33922

DIOPT Version :8

Sequence 1:NP_001027131.1 Gene:CG33688 / 3772065 FlyBaseID:FBgn0053688 Length:175 Species:Drosophila melanogaster
Sequence 2:NP_001027217.1 Gene:CG33922 / 3771945 FlyBaseID:FBgn0053922 Length:178 Species:Drosophila melanogaster

Alignment Length:166 Identity:59/166 - (35%)
Similarity:93/166 - (56%) Gaps:2/166 - (1%)


  Fly     9 IILGYLATVFNHVTFTNLKCGIRGEKIYYFEKCFIKAVNRTHKYIDIYVNLHQQVVNNVTV-IKL 72
            |.|..:..|...:.|||:||.....:...|..||:|:||||:||..:.|.|.:..|:||.: |..
  Fly    12 IFLFTIHLVICKLEFTNIKCVTLDPEFAVFHYCFLKSVNRTYKYYSLKVKLLKTPVSNVKINIAT 76

  Fly    73 MRHNNGYKPFFVDVTIDVCKFLKDPRQS-IIKKLYDIYKNNSNINHTCPYKDVVIVHHLWTGNLE 136
            .:..||||||..:||:|.|:|.|..|.: :....::.:|:.|||||:|||...:|:..:...:..
  Fly    77 FQRLNGYKPFLYNVTVDGCRFYKHQRSNPVFSYFFNFFKDYSNINHSCPYDHDIILDKVSISHAN 141

  Fly   137 SDFMKYLPLIDGDYAIYTEWSVYNVARAFIDVYIRV 172
            :.....||:..|:|....:|..||:.||.:|||.::
  Fly   142 TQVTNVLPVPHGNYLYRADWYAYNIKRATVDVYAKI 177

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33688NP_001027131.1 DUF1091 72..152 CDD:284008 27/80 (34%)
CG33922NP_001027217.1 DUF1091 72..156 CDD:284008 27/83 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.