DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33688 and CG33645

DIOPT Version :9

Sequence 1:NP_001027131.1 Gene:CG33688 / 3772065 FlyBaseID:FBgn0053688 Length:175 Species:Drosophila melanogaster
Sequence 2:NP_001027260.3 Gene:CG33645 / 3771913 FlyBaseID:FBgn0053645 Length:189 Species:Drosophila melanogaster


Alignment Length:184 Identity:44/184 - (23%)
Similarity:81/184 - (44%) Gaps:46/184 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IILGYLATVFNHVTFTNLKCGIRGEKIYYFEKCFIKAVNRTHKYIDIY----------------- 56
            ::|.:.||:.    |.:::|..|..::|      ||.||.||...|:|                 
  Fly     4 LLLFFSATLI----FNSMRCEERNFRVY------IKEVNITHLDTDLYEKFECKVYQVDNRTYMD 58

  Fly    57 -VNLHQQVVNNVTV---IKLMRHNNGYKPFFVDVTIDVCKFLKDPRQSIIKKLYDIY----KNNS 113
             |::.::.|:::||   :...:.|:..|....||..:.|..|::..::   :|:::|    |.:|
  Fly    59 SVHIFKRTVDDITVHAALDFWKLNSKQKMKLYDVQFNGCYILENANKN---RLFNMYVQNLKKHS 120

  Fly   114 NINHTCPYKDVVIVHHLWTGNL---ESDFMKYLPLIDGDYAIYTEWSVYNVARA 164
            |:...||::..|...   ..||   |.||..::||  |.:....|:......||
  Fly   121 NVKFKCPFRANVSYE---VKNLTMSEQDFPSFVPL--GKFRSLIEYCTNQKLRA 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33688NP_001027131.1 DUF1091 72..152 CDD:284008 22/86 (26%)
CG33645NP_001027260.3 DUF1091 80..156 CDD:310821 22/83 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.