DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33688 and CG33689

DIOPT Version :8

Sequence 1:NP_001027131.1 Gene:CG33688 / 3772065 FlyBaseID:FBgn0053688 Length:175 Species:Drosophila melanogaster
Sequence 2:NP_001027132.2 Gene:CG33689 / 3771798 FlyBaseID:FBgn0053689 Length:178 Species:Drosophila melanogaster

Alignment Length:174 Identity:97/175 (55%)
Similarity:135/175 (77%) Gaps:1/175 (1%)


  Fly     1 MRVFFLILIILGYLATVFNHVTFTNLKCGIRGEKIYYFEKCFIKAVNRTHKYIDIYVNLHQQVVN 65
            ||..|.:.||:|.|..:..|:||||:|||.:......|:|||||||||||||:|:||||::..::
  Fly     1 MRRLFNVFIIMGSLMAIHTHMTFTNIKCGSKDPTFAIFKKCFIKAVNRTHKYVDVYVNLYKLPID 65

  Fly    66 NVTV-IKLMRHNNGYKPFFVDVTIDVCKFLKDPRQSIIKKLYDIYKNNSNINHTCPYKDVVIVHH 129
            |:|: .:||||::||||||:|.|.|.||||::.:..|||..|.||:.:|||||||||...:||.|
  Fly    66 NITISFRLMRHDHGYKPFFIDYTFDGCKFLRNQKHPIIKLFYKIYQGSSNINHTCPYDHDIIVDH 130

  Fly   130 LWTGNLESDFMKYLPLIDGDYAIYTEWSVYNVARAFIDVYIRVS 173
            |||||:||||:||:|:|:||||:|:.||..|:.||::::|.||:
  Fly   131 LWTGNIESDFLKYIPMINGDYAVYSNWSTDNIMRAYLNLYFRVT 174

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33688NP_001027131.1 DUF1091 72..152 CDD:284008 52/80 (65%)
CG33689NP_001027132.2 DUF1091 73..153 CDD:284008 52/80 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131095548
eggNOG 1 0.900 E1_2FJG4
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.