powered by:
                  
 
    
 
    
             
          
            Protein Alignment CG33688 and CG33631
  DIOPT Version :9 
      
        
          
            | Sequence 1: | NP_001027131.1 | 
            Gene: | CG33688 / 3772065 | 
            FlyBaseID: | FBgn0053688 | 
            Length: | 175 | 
            Species: | Drosophila melanogaster | 
          
          
            | Sequence 2: | NP_001027167.1 | 
            Gene: | CG33631 / 3771784 | 
            FlyBaseID: | FBgn0053631 | 
            Length: | 195 | 
            Species: | Drosophila melanogaster | 
          
        
        
        
          
            | Alignment Length: | 146 | 
            Identity: | 31/146 - (21%) | 
          
          
            | Similarity: | 58/146 -  (39%) | 
            Gaps: | 54/146 - (36%) | 
          
        
      
- Green bases have known domain annotations that are detailed below.
      | 
 
  Fly    42 FIKAVNRTHKYID-------IYVNLHQQVVNNVTV--IKLMRHNNGYKPFFVDVT------IDVC 91 
            |:||::    |||       |:::|.:::.:|...  ||:.....|...|   ||      :|:| 
  Fly    53 FMKALS----YIDETRLKFTIFISLREELGSNFLTFNIKIRVRPTGRTNF---VTLLQMRDLDLC 110 
 
  Fly    92 KFLKDPRQSIIKKLYDIYKNNSNINHTCPYKDVVIVHHLWTGNLESDFMKYLPLIDGDYAIYTEW 156 
            .|..:.|::.:.|.:        :.......|:::                .|:..|:|       
  Fly   111 GFFTEFRKNPMMKYF--------LQSEMQLSDIIV----------------CPVRVGNY------ 145 
 
  Fly   157 SVYNVARAFIDVYIRV 172 
            ||.||  :..|:|.:| 
  Fly   146 SVKNV--SVKDIYPQV 159 
 
       | 
      
        Known Domains:
         Indicated by green bases in alignment.
        
      
      
      
        Information from Original Tools:
        
        
          
            | Tool | 
            Simple Score | 
            Weighted Score | 
            Original Tool Information | 
          
          
            | BLAST Result | 
            Score | 
            Score Type | 
            Cluster ID | 
          
          
          
            | Compara | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | Domainoid | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | eggNOG | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | Homologene | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | Inparanoid | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | Isobase | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | OMA | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | OrthoDB | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | OrthoFinder | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | OrthoInspector | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | orthoMCL | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | Panther | 
            1 | 
            1.100 | 
            - | 
            - | 
            P | 
            PTHR20898 | 
          
          
            | Phylome | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | RoundUp | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | SonicParanoid | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
             | 
            1 | 1.100 | 
             | 
          
        
      
           
             Return to query results.
             Submit another query.