DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33688 and CG33631

DIOPT Version :9

Sequence 1:NP_001027131.1 Gene:CG33688 / 3772065 FlyBaseID:FBgn0053688 Length:175 Species:Drosophila melanogaster
Sequence 2:NP_001027167.1 Gene:CG33631 / 3771784 FlyBaseID:FBgn0053631 Length:195 Species:Drosophila melanogaster


Alignment Length:146 Identity:31/146 - (21%)
Similarity:58/146 - (39%) Gaps:54/146 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 FIKAVNRTHKYID-------IYVNLHQQVVNNVTV--IKLMRHNNGYKPFFVDVT------IDVC 91
            |:||::    |||       |:::|.:::.:|...  ||:.....|...|   ||      :|:|
  Fly    53 FMKALS----YIDETRLKFTIFISLREELGSNFLTFNIKIRVRPTGRTNF---VTLLQMRDLDLC 110

  Fly    92 KFLKDPRQSIIKKLYDIYKNNSNINHTCPYKDVVIVHHLWTGNLESDFMKYLPLIDGDYAIYTEW 156
            .|..:.|::.:.|.:        :.......|:::                .|:..|:|      
  Fly   111 GFFTEFRKNPMMKYF--------LQSEMQLSDIIV----------------CPVRVGNY------ 145

  Fly   157 SVYNVARAFIDVYIRV 172
            ||.||  :..|:|.:|
  Fly   146 SVKNV--SVKDIYPQV 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33688NP_001027131.1 DUF1091 72..152 CDD:284008 13/85 (15%)
CG33631NP_001027167.1 DUF1091 84..167 CDD:284008 22/111 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.