DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33688 and CG13193

DIOPT Version :8

Sequence 1:NP_001027131.1 Gene:CG33688 / 3772065 FlyBaseID:FBgn0053688 Length:175 Species:Drosophila melanogaster
Sequence 2:NP_610699.1 Gene:CG13193 / 36256 FlyBaseID:FBgn0033650 Length:189 Species:Drosophila melanogaster

Alignment Length:147 Identity:34/148 (23%)
Similarity:67/148 (45%) Gaps:35/148 (24%)


  Fly    23 FTNL--KC------GIRGEKIYYFEKCFIKAVNRTHKYIDIYVN--LHQQVVNNVTVIKLMRHNN 77
            |||:  :|      .|||         ::.|....:  :||::|  |...:...:|:::|:...:
  Fly    37 FTNISVECSKDYCSSIRG---------WLTAKGELN--LDIHLNRTLKNGLRTTITLLQLIDGKD 90

  Fly    78 GYKPFFVDVTIDVCKFLKDPRQSIIKKLY--DIYKNNSNINHTCP-------YKDVVIVHHLWTG 133
            .|:..| ...:|.||.|::..||.:.|::  :::| ..|:...||       .::..:.:|...|
  Fly    91 RYQTLF-SYDMDTCKTLRELLQSSLMKVWLRNVFK-YGNLADRCPIQPASYDVRNFQLENHSIPG 153

  Fly   134 NLESDFMKYLPLIDGDY 150
            .|.:.|.:   |.|.:|
  Fly   154 YLPAGFYR---LHDTNY 167

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33688NP_001027131.1 DUF1091 72..152 CDD:284008 21/89 (24%)
CG13193NP_610699.1 DM8 91..183 CDD:214778 20/83 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.