DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33688 and CG33467

DIOPT Version :8

Sequence 1:NP_001027131.1 Gene:CG33688 / 3772065 FlyBaseID:FBgn0053688 Length:175 Species:Drosophila melanogaster
Sequence 2:NP_001286440.1 Gene:CG33467 / 2768834 FlyBaseID:FBgn0053467 Length:188 Species:Drosophila melanogaster

Alignment Length:177 Identity:36/177 - (20%)
Similarity:81/177 - (45%) Gaps:26/177 - (14%)


  Fly     5 FLILIILGYLATVFNHVT-------FTNLKCGIRGEKIYYFEKCFIKAVNRTHKYIDIYVNLHQQ 62
            :|:|:.:.::    .|:|       ||.::|.....::... .|.:|.:|.....:::...|...
  Fly     5 WLVLLSICFI----GHMTDSQLVYKFTKVECQGNQARVKNV-SCNVKPINWNTALVNLDCYLIYP 64

  Fly    63 VVN-NVTVIKLMR-HNNGYKPFFVDVTIDVCKFLKDPRQSIIK---KLYDIYKNNSNINHTCPYK 122
            ::| .:.|...|: ::|.||||.:|.|..:|..::  |::.:.   .::::::..:|:. :|...
  Fly    65 LINPTIRVQVFMKDYSNQYKPFLIDATFKLCDVVE--RKNFLPYAVMVWELFQRFTNVK-SCHIS 126

  Fly   123 DVVIVHHLWTGNLESDFMKYLPLIDGDYAIYTEWSVYN-VARAFIDV 168
            ..:...:   |.|.|.::.  |...|.|.|...:|..| ..|.|:.:
  Fly   127 GQLSARN---GYLNSSYVP--PFPHGQYQISVMFSDSNSTNREFVGI 168

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33688NP_001027131.1 DUF1091 72..152 CDD:284008 18/83 (22%)
CG33467NP_001286440.1 DUF1091 70..151 CDD:284008 19/88 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2FJG4
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.