DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33688 and CG33467

DIOPT Version :10

Sequence 1:NP_001027131.1 Gene:CG33688 / 3772065 FlyBaseID:FBgn0053688 Length:175 Species:Drosophila melanogaster
Sequence 2:NP_001286440.1 Gene:CG33467 / 2768834 FlyBaseID:FBgn0053467 Length:188 Species:Drosophila melanogaster


Alignment Length:177 Identity:36/177 - (20%)
Similarity:81/177 - (45%) Gaps:26/177 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 FLILIILGYLATVFNHVT-------FTNLKCGIRGEKIYYFEKCFIKAVNRTHKYIDIYVNLHQQ 62
            :|:|:.:.::    .|:|       ||.::|.....::... .|.:|.:|.....:::...|...
  Fly     5 WLVLLSICFI----GHMTDSQLVYKFTKVECQGNQARVKNV-SCNVKPINWNTALVNLDCYLIYP 64

  Fly    63 VVN-NVTVIKLMR-HNNGYKPFFVDVTIDVCKFLKDPRQSIIK---KLYDIYKNNSNINHTCPYK 122
            ::| .:.|...|: ::|.||||.:|.|..:|..::  |::.:.   .::::::..:|:. :|...
  Fly    65 LINPTIRVQVFMKDYSNQYKPFLIDATFKLCDVVE--RKNFLPYAVMVWELFQRFTNVK-SCHIS 126

  Fly   123 DVVIVHHLWTGNLESDFMKYLPLIDGDYAIYTEWSVYN-VARAFIDV 168
            ..:...:   |.|.|.::.  |...|.|.|...:|..| ..|.|:.:
  Fly   127 GQLSARN---GYLNSSYVP--PFPHGQYQISVMFSDSNSTNREFVGI 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33688NP_001027131.1 DUF1091 72..152 CDD:461928 18/83 (22%)
CG33467NP_001286440.1 DUF1091 70..151 CDD:461928 19/88 (22%)

Return to query results.
Submit another query.