powered by:
                   
 
    
    
             
          
            Protein Alignment CG33688 and CG33483
  DIOPT Version :9 
      
        
          
            | Sequence 1: | NP_001027131.1 | Gene: | CG33688 / 3772065 | FlyBaseID: | FBgn0053688 | Length: | 175 | Species: | Drosophila melanogaster | 
          
            | Sequence 2: | NP_001189327.1 | Gene: | CG33483 / 2768693 | FlyBaseID: | FBgn0053483 | Length: | 229 | Species: | Drosophila melanogaster | 
        
        
        
          
            | Alignment Length: | 155 | Identity: | 56/155 - (36%) | 
          
            | Similarity: | 90/155 -  (58%) | Gaps: | 2/155 - (1%) | 
        
      
- Green bases have known domain annotations that are detailed below.
      | 
  Fly    21 VTFTNLKCGIRGEKIYYFEKCFIKAVNRTHKYIDIYVNLHQQVVNNVTV-IKLMRHNNGYKPFFV 84|.|||:||....:....||.|.:|:|||:.||:.:.||||:..:..|.| ..|::..||||||..
 Fly    75 VEFTNIKCTSWDKAFDDFEYCHLKSVNRSFKYLSLKVNLHKVPITKVKVNFSLLKRFNGYKPFLY 139
 
 
  Fly    85 DVTIDVCKFLKDPRQS-IIKKLYDIYKNNSNINHTCPYKDVVIVHHLWTGNLESDFMKYLPLIDG 148::|:|.||.|:..:.: |....|.::|::||:|||||:...:||..|.|..:.......:....|
 Fly   140 NITVDACKALRHSKYNPIFSFFYGLFKHHSNMNHTCPFDHDLIVEKLPTNFMNQKVNGDIKFPHG 204
 
 
  Fly   149 DYAIYTEWSVYNVARAFIDVYIRVS 173||..:::|..|.:.||.:|.::.:|
 Fly   205 DYLFHSDWYAYGINRATVDFFLTLS 229
 
 | 
      
        Known Domains:
         Indicated by green bases in alignment.
        
      
      
      
        Information from Original Tools:
        
        
          
            | Tool | Simple Score | Weighted Score | Original Tool Information | 
          
            | BLAST Result | Score | Score Type | Cluster ID | 
          
          
            | Compara | 0 | 0.000 | Not matched by this tool. | 
          
            | Domainoid | 1 | 1.000 | 52 | 1.000 | Domainoid score | I18610 | 
          
            | eggNOG | 1 | 0.900 | - | - |  | E1_2FJG4 | 
          
            | Homologene | 0 | 0.000 | Not matched by this tool. | 
          
            | Inparanoid | 0 | 0.000 | Not matched by this tool. | 
          
            | Isobase | 0 | 0.000 | Not matched by this tool. | 
          
            | OMA | 0 | 0.000 | Not matched by this tool. | 
          
            | OrthoDB | 0 | 0.000 | Not matched by this tool. | 
          
            | OrthoFinder | 1 | 1.000 | - | - |  | FOG0000262 | 
          
            | OrthoInspector | 0 | 0.000 | Not matched by this tool. | 
          
            | orthoMCL | 0 | 0.000 | Not matched by this tool. | 
          
            | Panther | 1 | 1.100 | - | - | P | PTHR20898 | 
          
            | Phylome | 1 | 0.910 | - | - |  |  | 
          
            | RoundUp | 0 | 0.000 | Not matched by this tool. | 
          
            | SonicParanoid | 0 | 0.000 | Not matched by this tool. | 
          
            |  | 5 | 4.910 |  | 
        
      
           
             Return to query results.
             Submit another query.