DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17768 and LSM4

Sequence 1:NP_001027236.1 Gene:CG17768 FlyBaseID:FBgn0032240 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_011037.3 Gene:LSM4 SGDID:S000000914 Length:187 Species:Saccharomyces cerevisiae

Alignment Length:164 Identity:54/165 (33%)
Similarity:77/165 (47%) Gaps:32/165 (19%)


  Fly     1 MLPLSLLKTAQSHPMLVELKNGETYNGHLVSCDSWMNINLRDVICTSK----------DGDRFWR 55
            ||||.||..|:...|.:||||||...|.|.:.|:|||:.|.:|...|:          :..:..:
Yeast     1 MLPLYLLTNAKGQQMQIELKNGEIIQGILTNVDNWMNLTLSNVTEYSEESAINSEDNAESSKAVK 65

  Fly    56 MPECYIRGSTIKYLRIPDEVIDMVKEDAQAKSRNRTEMNKNRGGNSSQNQRGGRPGGGNRNNVGN 120
            :.|.||||:.||::::.|.:||.||:  |..|.|    |.|..|...:.....|....||.|...
Yeast    66 LNEIYIRGTFIKFIKLQDNIIDKVKQ--QINSNN----NSNSNGPGHKRYYNNRDSNNNRGNYNR 124

  Fly   121 RPGQGYGGAANNAMRLGGAAGQGNRLPHAAKNRK 154
            |..       ||        |..||.|: ::||:
Yeast   125 RNN-------NN--------GNSNRRPY-SQNRQ 142

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17768NP_001027236.1 LSm4 2..77 CDD:212470 31/85 (36%)
LSM4NP_011037.3 LSm4 2..87 CDD:212470 31/85 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C214259365
eggNOG 1 0.900 E1_KOG3293
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 75 1.000 Inparanoid score I1634
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004264
OrthoInspector 1 1.000 T1136470
orthoMCL 1 0.900 OOG5_128255
Panther 1 1.100 LDO PTHR23338
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R668
TreeFam 1 0.960
1110.780

Return to query results.
Submit another query.