DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17768 and emb1644

Sequence 1:NP_001027236.1 Gene:CG17768 FlyBaseID:FBgn0032240 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_198124.1 Gene:emb1644 AraportID:AT5G27720 Length:129 Species:Arabidopsis thaliana

Alignment Length:127 Identity:82/128 (64%)
Similarity:94/128 (73%) Gaps:0/128 (0%)


  Fly     1 MLPLSLLKTAQSHPMLVELKNGETYNGHLVSCDSWMNINLRDVICTSKDGDRFWRMPECYIRGST 65
            |||||||||||.||||||||||||||||||:||:||||:||:|||||||||||||||||||||:|
plant     1 MLPLSLLKTAQGHPMLVELKNGETYNGHLVNCDTWMNIHLREVICTSKDGDRFWRMPECYIRGNT 65

  Fly    66 IKYLRIPDEVIDMVKEDAQAKSRNRTEMNKNRGGNSSQNQRGGRPGGGNRNNVGNRPGQGYG 127
            |||||:||||||.|:|:.....|....:.:.||.........||..|.:...:|...|.|.|
plant    66 IKYLRVPDEVIDKVQEEKTRTDRKPPGVGRGRGRGVDDGGARGRGRGTSMGKMGGNRGAGRG 127

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17768NP_001027236.1 LSm4 2..77 CDD:212470 68/75 (91%)
emb1644NP_198124.1 LSm4 2..77 CDD:212470 68/75 (91%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 173 1.000 Inparanoid score I1476
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T193030
orthoMCL 1 0.900 OOG5_128255
Panther 1 1.100 O PTHR23338
Phylome 00.000 Not matched by this tool.
55.050

Return to query results.
Submit another query.