DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17768 and Lsm4

Sequence 1:NP_001027236.1 Gene:CG17768 FlyBaseID:FBgn0032240 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_056631.2 Gene:Lsm4 MGIID:1354692 Length:138 Species:Mus musculus

Alignment Length:148 Identity:97/149 (65%)
Similarity:108/149 (72%) Gaps:18/149 (12%)


  Fly     1 MLPLSLLKTAQSHPMLVELKNGETYNGHLVSCDSWMNINLRDVICTSKDGDRFWRMPECYIRGST 65
            |||||||||||:|||||||||||||||||||||:|||||||:|||||:|||:|||||||||||||
Mouse     1 MLPLSLLKTAQNHPMLVELKNGETYNGHLVSCDNWMNINLREVICTSRDGDKFWRMPECYIRGST 65

  Fly    66 IKYLRIPDEVIDMVKEDAQAKSRNRTEMNKNRGGNSSQNQRGGR-PGGGNRNNVGNRPGQGYGGA 129
            |||||||||:||||:|:| ||.|       .|||...|.|:.|| .||..|...|   |:|.||.
Mouse    66 IKYLRIPDEIIDMVREEA-AKGR-------GRGGPQQQKQQKGRGMGGAGRGVFG---GRGRGGI 119

  Fly   130 ANNAMRLGGAAGQGNRLP 147
            .      |...||..:.|
Mouse   120 P------GAGRGQPEKKP 131

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17768NP_001027236.1 LSm4 2..77 CDD:212470 69/75 (92%)
Lsm4NP_056631.2 LSm4 2..77 CDD:212470 69/75 (92%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C214252088
eggNOG 1 0.900 E1_KOG3293
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 181 1.000 Inparanoid score I3948
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004264
OrthoInspector 1 1.000 T1084447
orthoMCL 1 0.900 OOG5_128255
Panther 1 1.100 LDO PTHR23338
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
109.750

Return to query results.
Submit another query.