DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17768 and lsm4

Sequence 1:NP_001027236.1 Gene:CG17768 FlyBaseID:FBgn0032240 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_989371.1 Gene:lsm4 XenbaseID:XB-GENE-945533 Length:138 Species:Xenopus tropicalis

Alignment Length:148 Identity:95/149 (64%)
Similarity:107/149 (72%) Gaps:18/149 (12%)


  Fly     1 MLPLSLLKTAQSHPMLVELKNGETYNGHLVSCDSWMNINLRDVICTSKDGDRFWRMPECYIRGST 65
            |||||||||||:|||||||||||||||||||||:|||||||:|||||:|||:|||||||||||||
 Frog     1 MLPLSLLKTAQNHPMLVELKNGETYNGHLVSCDNWMNINLREVICTSRDGDKFWRMPECYIRGST 65

  Fly    66 IKYLRIPDEVIDMVKEDAQAKSRNRTEMNKNRGGNSSQNQRGGRPGGGNRNNVGNRPGQG-YGGA 129
            |||||||||:||||||:..:|.|       .|||...|.|..||..||        .|:| :||.
 Frog    66 IKYLRIPDEIIDMVKEEVMSKGR-------GRGGMQQQKQMKGRGAGG--------AGRGVFGGR 115

  Fly   130 ANNAMRLGGAAGQGNRLP 147
            .....  ||..||.::.|
 Frog   116 GRGVP--GGGRGQQDKKP 131

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17768NP_001027236.1 LSm4 2..77 CDD:212470 69/75 (92%)
lsm4NP_989371.1 LSm4 2..77 CDD:212470 69/75 (92%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C214253176
eggNOG 1 0.900 E1_KOG3293
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004264
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R668
TreeFam 1 0.960
65.730

Return to query results.
Submit another query.