DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17768 and lsm4

Sequence 1:NP_001027236.1 Gene:CG17768 FlyBaseID:FBgn0032240 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_956990.1 Gene:lsm4 ZFINID:ZDB-GENE-040426-1652 Length:143 Species:Danio rerio

Alignment Length:147 Identity:95/148 (64%)
Similarity:109/148 (74%) Gaps:9/148 (6%)


  Fly     1 MLPLSLLKTAQSHPMLVELKNGETYNGHLVSCDSWMNINLRDVICTSKDGDRFWRMPECYIRGST 65
            |||||||||||:|||||||||||||||||||||:|||||||:|||||:|||:|||||||||||||
Zfish     1 MLPLSLLKTAQNHPMLVELKNGETYNGHLVSCDNWMNINLREVICTSRDGDKFWRMPECYIRGST 65

  Fly    66 IKYLRIPDEVIDMVKEDAQAKSRNRTEMNKNRGGNSSQNQRGGRPGGGNRNNVGNRPGQGYGGAA 130
            |||||||||:||||||:..:|.|.|..|.:|:      .|..||.||..|   |..||:|..|..
Zfish    66 IKYLRIPDEIIDMVKEEVVSKGRGRGGMQQNK------PQGKGRGGGPGR---GGGPGRGVFGGR 121

  Fly   131 NNAMRLGGAAGQGNRLP 147
            ...|:..|...|.::.|
Zfish   122 GRGMQGSGRGQQQDKKP 138

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17768NP_001027236.1 LSm4 2..77 CDD:212470 69/75 (92%)
lsm4NP_956990.1 LSm4 2..77 CDD:212470 69/75 (92%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C214251642
eggNOG 1 0.900 E1_KOG3293
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 189 1.000 Inparanoid score I3823
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004264
OrthoInspector 1 1.000 T1053634
orthoMCL 1 0.900 OOG5_128255
Panther 1 1.100 LDO PTHR23338
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R668
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1211.790

Return to query results.
Submit another query.