DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17768 and SmD3

Sequence 1:NP_001027236.1 Gene:CG17768 FlyBaseID:FBgn0032240 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_725106.1 Gene:SmD3 FlyBaseID:FBgn0023167 Length:151 Species:Drosophila melanogaster

Alignment Length:154 Identity:46/155 (30%)
Similarity:67/155 (43%) Gaps:23/155 (15%)


  Fly     2 LPLSLLKTAQSHPMLVELKNGETYNGHLVSCDSWMNINLRDVICTSKDGDRFWRMPECYIRGSTI 66
            :|:.:|..|:.|.:..|...||.|.|.|:..:..||..:..:..|.:|| |...:...|||||.|
  Fly     5 VPIKVLHEAEGHIITCETITGEVYRGKLIEAEDNMNCQMTQITVTYRDG-RTANLENVYIRGSKI 68

  Fly    67 KYLRIPDEVIDMVKEDAQAKSRNRTEMNKNRGGNSSQNQ------------RGGRPGGGNRNNVG 119
            ::|.:|    ||:|.....|.    :..|..||.:.:.:            |||.||||  ...|
  Fly    69 RFLILP----DMLKNAPMFKK----QTGKGLGGTAGRGKAAILRAQARGRGRGGPPGGG--RGTG 123

  Fly   120 NRPGQGYGGAANNAMRLGGAAGQG 143
            ..||...|.....|.:.|...|:|
  Fly   124 GPPGAPGGSGGRGAWQGGPTGGRG 147

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17768NP_001027236.1 LSm4 2..77 CDD:212470 24/75 (32%)
SmD3NP_725106.1 Sm_D3 6..75 CDD:212468 24/74 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C107746357
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR23338
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.