DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17768 and LSM4

Sequence 1:NP_001027236.1 Gene:CG17768 FlyBaseID:FBgn0032240 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_036453.1 Gene:LSM4 HGNCID:17259 Length:139 Species:Homo sapiens

Alignment Length:155 Identity:97/156 (62%)
Similarity:108/156 (69%) Gaps:21/156 (13%)


  Fly     1 MLPLSLLKTAQSHPMLVELKNGETYNGHLVSCDSWMNINLRDVICTSKDGDRFWRMPECYIRGST 65
            |||||||||||:|||||||||||||||||||||:|||||||:|||||:|||:|||||||||||||
Human     1 MLPLSLLKTAQNHPMLVELKNGETYNGHLVSCDNWMNINLREVICTSRDGDKFWRMPECYIRGST 65

  Fly    66 IKYLRIPDEVIDMVKEDAQAKSRNRTEMNKNRGGNSSQNQRGGRPGGGNRNNVGNRPGQG-YGGA 129
            |||||||||:||||||:..||.|       .|||...|.|:.||..||        .|:| :||.
Human    66 IKYLRIPDEIIDMVKEEVVAKGR-------GRGGLQQQKQQKGRGMGG--------AGRGVFGGR 115

  Fly   130 ANNAMRLGGAAGQGNRLPHAAKNRK 154
            ..     ||..|.|...|.....|:
Human   116 GR-----GGIPGTGRGQPEKKPGRQ 135

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17768NP_001027236.1 LSm4 2..77 CDD:212470 69/75 (92%)
LSM4NP_036453.1 LSm4 2..77 CDD:212470 69/75 (92%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C214251548
eggNOG 1 0.900 E1_KOG3293
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 185 1.000 Inparanoid score I3901
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004264
OrthoInspector 1 1.000 T1074351
orthoMCL 1 0.900 OOG5_128255
Panther 1 1.100 LDO PTHR23338
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R668
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1110.780

Return to query results.
Submit another query.