DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17768 and lsm4

Sequence 1:NP_001027236.1 Gene:CG17768 FlyBaseID:FBgn0032240 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_001342832.1 Gene:lsm4 PomBaseID:SPBC30D10.06 Length:121 Species:Schizosaccharomyces pombe

Alignment Length:129 Identity:69/130 (53%)
Similarity:87/130 (67%) Gaps:11/130 (8%)


  Fly     1 MLPLSLLKTAQSHPMLVELKNGETYNGHLVSCDSWMNINLRDVICTSKDGDRFWRMPECYIRGST 65
            ||||:||...|..|:|||||||||:||||.:||::||:.||:||.|..|||:|:|:|||||||:.
pombe     1 MLPLTLLNATQGRPILVELKNGETFNGHLENCDNYMNLTLREVIRTMPDGDKFFRLPECYIRGNN 65

  Fly    66 IKYLRIPDEVIDMV-KEDAQAKSRNRTEMNKNRGGNSSQNQRGGRPGGGNRNNVGNRPGQGYGG 128
            ||||||.|||:..| |:.||.:        :|||  |....||.|..|...:...||.|:|.||
pombe    66 IKYLRIQDEVLSQVAKQQAQQR--------ENRG--SRFRGRGQRGRGNYGHTAPNRRGRGRGG 119

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17768NP_001027236.1 LSm4 2..77 CDD:212470 50/75 (67%)
lsm4NP_001342832.1 LSm4 2..77 CDD:212470 50/75 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 129 1.000 Inparanoid score I1408
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004264
OrthoInspector 1 1.000 T1125411
orthoMCL 1 0.900 OOG5_128255
Panther 1 1.100 LDO PTHR23338
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R668
TreeFam 1 0.960
109.960

Return to query results.
Submit another query.