DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: HemK2 and MTQ1

Sequence 1:NP_001027221.1 Gene:HemK2 FlyBaseID:FBgn0031454 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_014336.1 Gene:MTQ1 SGDID:S000005007 Length:314 Species:Saccharomyces cerevisiae

Alignment Length:164 Identity:37/165 (22%)
Similarity:65/165 (39%) Gaps:21/165 (13%)


  Fly    18 YEPAEDSFLLLDALEKDLEYLDRLQPSLCVELGSGSGVIITALAKKLAGFSLCLATDINPKACNA 82
            :|..|....::.||...:.....:...:| :..:|:|.|..||:..:|..:. .|.|::.:|...
Yeast    87 WETEEWVMAIIRALNNSMLSRHTIPLHIC-DTFTGTGCIALALSHGIANCTF-TAIDVSTRAIKL 149

  Fly    83 TRRTATRN---GARL--DSIRCSLADALRPRSVDVLLFNPPYV----VTSDEELQTQQFDSH--- 135
            .:....:|   |.:|  .:|..|.|....|..:|:|..||||:    ...|.:...:.|:..   
Yeast   150 VKENMLKNKVSGGKLVQHNILSSKASDEYPSHIDILTGNPPYIRKRDFNRDVKTSVKLFEPRLAL 214

  Fly   136 -SESSTDRNLVFSWAGGQDGRRVTDILLKQLDDI 168
             .|.....|||..|.      ..||....::.|:
Yeast   215 VGELECYINLVNYWL------PKTDSFFYEIGDV 242

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HemK2NP_001027221.1 AdoMet_MTases 15..219 CDD:302624 37/165 (22%)
HemK <15..193 CDD:225443 37/165 (22%)
MTQ1NP_014336.1 hemK_fam 1..283 CDD:273125 37/165 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2890
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R762
TreeFam 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.