DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: HemK2 and MTQ2

Sequence 1:NP_001027221.1 Gene:HemK2 FlyBaseID:FBgn0031454 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_010424.3 Gene:MTQ2 SGDID:S000002547 Length:221 Species:Saccharomyces cerevisiae

Alignment Length:239 Identity:95/240 (40%)
Similarity:127/240 (53%) Gaps:39/240 (16%)


  Fly     1 METPYTDHLSPEDFEHVYEPAEDSFLLLDALEKDLEYL-----DRLQPSLCVELGSGSGVIITAL 60
            :.|||...    |::.||||||||||:||.|||:.::|     :||  ::..|:|||||::.|.|
Yeast     2 LPTPYVKC----DYDKVYEPAEDSFLILDCLEKEHDFLKQKFGNRL--AIVCEIGSGSGIVTTFL 60

  Fly    61 AKKL---AGFSLCLATDINPKACNATRRTATRNGAR---LDSIRCSLADALRPRSVDVLLFNPPY 119
            .:..   ...|:.||.||||.|..||..||..|..:   |:.|:..|..::|...||||:|||||
Yeast    61 MQNKIIPQENSIHLAVDINPWALEATLDTAKLNSCKSSFLEVIQADLNSSIRNNQVDVLIFNPPY 125

  Fly   120 VVT--------SDEELQTQQFDSHSESSTDRNLVFSWAGGQDGRRVTDILLKQLDDILSPRGVLY 176
            |..        |.||             .|:.|..:..||:||..:||.||:||:.||||.||.|
Yeast   126 VPAECVPDVPGSREE-------------ADQWLDLALLGGKDGMAITDKLLRQLEQILSPDGVAY 177

  Fly   177 LLLLRENKPEEIIKYLEGLQFRAVKFMERRIPG-EHLCILKVTR 219
            :|....|||:|:||.........||.:|.|..| |.|.:...||
Yeast   178 ILFCARNKPKEVIKRFVDTYKWNVKLIETRKAGWEVLSVYSFTR 221

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HemK2NP_001027221.1 AdoMet_MTases 15..219 CDD:302624 90/224 (40%)
HemK <15..193 CDD:225443 82/197 (42%)
MTQ2NP_010424.3 AdoMet_MTases 12..221 CDD:327401 90/224 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C4132629
eggNOG 1 0.900 E1_COG2890
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003900
OrthoInspector 1 1.000 T1136597
orthoMCL 1 0.900 OOG5_127713
Panther 1 1.100 LDO PTHR45875
Phylome 1 0.910 0.979 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R762
TreeFam 1 0.960
1110.740

Return to query results.
Submit another query.