DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: HemK2 and N6AMT1

Sequence 1:NP_001027221.1 Gene:HemK2 FlyBaseID:FBgn0031454 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_037372.4 Gene:N6AMT1 HGNCID:16021 Length:214 Species:Homo sapiens

Alignment Length:220 Identity:86/221 (39%)
Similarity:125/221 (57%) Gaps:17/221 (8%)


  Fly     3 TPYTDHLSPEDFEHVYEPAEDSFLLLDALEKDLEYLDRLQPSLCVELGSGSGVIITALAKKLAGF 67
            ||:..|:....|..|||||||:||||||||.....|..::  :|:|:||||||:...||..:...
Human     8 TPFHGHVGRGAFSDVYEPAEDTFLLLDALEAAAAELAGVE--ICLEVGSGSGVVSAFLASMIGPQ 70

  Fly    68 SLCLATDINPKACNATRRTATRNGARLDSIRCSLADALRPR---SVDVLLFNPPYVVTSDEELQT 129
            :|.:.|||||:|...|..||..|...:..:...|...|.||   .||:|:||||||||..:|:.:
Human    71 ALYMCTDINPEAAACTLETARCNKVHIQPVITDLVKGLLPRLTEKVDLLVFNPPYVVTPPQEVGS 135

  Fly   130 QQFDSHSESSTDRNLVFSWAGGQDGRRVTDILLKQLDDILSPRGVLYLLLLRENKPEEIIKYLEG 194
            ...::            :||||::||.|.|.....:.|:|||||:.||:.::||.||||:|.::.
Human   136 HGIEA------------AWAGGRNGREVMDRFFPLVPDLLSPRGLFYLVTIKENNPEEILKIMKT 188

  Fly   195 LQFRAVKFMERRIPGEHLCILKVTR 219
            ...:....:.|:...|.|.:||.|:
Human   189 KGLQGTTALSRQAGQETLSVLKFTK 213

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HemK2NP_001027221.1 AdoMet_MTases 15..219 CDD:302624 82/207 (40%)
HemK <15..193 CDD:225443 76/181 (42%)
N6AMT1NP_037372.4 AdoMet_MTases 21..213 CDD:327401 82/206 (40%)
S-adenosyl-L-methionine binding. {ECO:0000250|UniProtKB:P0ACC1, ECO:0000255|HAMAP-Rule:MF_02126} 53..57 4/4 (100%)
Substrate binding. {ECO:0000250|UniProtKB:P0ACC1} 122..125 3/3 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C4129348
eggNOG 1 0.900 E1_COG2890
Hieranoid 1 1.000
Homologene 1 1.000 H5637
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003900
OrthoInspector 1 1.000 T1074658
orthoMCL 1 0.900 OOG5_127713
Panther 1 1.100 LDO PTHR45875
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R762
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1211.740

Return to query results.
Submit another query.