DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: HemK2 and SPAC29B12.05c

Sequence 1:NP_001027221.1 Gene:HemK2 FlyBaseID:FBgn0031454 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_594983.1 Gene:SPAC29B12.05c PomBaseID:SPAC29B12.05c Length:309 Species:Schizosaccharomyces pombe

Alignment Length:182 Identity:44/183 (24%)
Similarity:70/183 (38%) Gaps:51/183 (28%)


  Fly    35 LEYLDRLQPSLCVELGSGSGVIITALAKKLAGFSLCLATDINPKACNATRRTATRNGAR--LDSI 97
            |..|:||:|...::|.:|||.|.:.:...|.......|.|::.||.....:...|..|.  :..|
pombe   109 LNRLERLKPLKILDLCTGSGCISSFVLANLRVPHTIEAVDVSKKALKLAVKNCDRAIAHGTVGKI 173

  Fly    98 RCSLADALRP--------RSVDVLLFNPPYVVTSDEELQTQQFDSHSESSTDRNLVFSWAGGQDG 154
            .....|.|..        ::..|||.||||:  ||::...|                        
pombe   174 NFHQIDVLNEHERVESLLQTSHVLLCNPPYI--SDDDFAAQ------------------------ 212

  Fly   155 RRVTDILLKQLDDILSPRGVLYLLLLRENKPEEIIKYLEGLQFRAVKFMERR 206
               |||.:::.:    |:    |.||.:|...|.  |.:..|:  :|.|.:|
pombe   213 ---TDISVRKYE----PK----LALLAKNGGNEF--YYKFSQY--IKRMLQR 249

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HemK2NP_001027221.1 AdoMet_MTases 15..219 CDD:302624 44/183 (24%)
HemK <15..193 CDD:225443 40/168 (24%)
SPAC29B12.05cNP_594983.1 HemK 30..305 CDD:225443 44/183 (24%)
AdoMet_MTases 65..>226 CDD:302624 35/154 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R762
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.