DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: HemK2 and SPAC323.05c

Sequence 1:NP_001027221.1 Gene:HemK2 FlyBaseID:FBgn0031454 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_594375.1 Gene:SPAC323.05c PomBaseID:SPAC323.05c Length:231 Species:Schizosaccharomyces pombe

Alignment Length:236 Identity:87/237 (37%)
Similarity:124/237 (52%) Gaps:31/237 (13%)


  Fly     1 METPYTDHLSPEDFEHVYEPAEDSFLLLDALEKD---LEYLDRLQPSLCVELGSGSGVIITALA- 61
            :.||.|..|..::|:.|||||||:|.||||||||   |..:..::..|..|:|.|||...:.|. 
pombe     2 LSTPVTSQLRLKEFQDVYEPAEDTFALLDALEKDAKKLRQMAEMKNLLTAEIGCGSGCASSFLKS 66

  Fly    62 -----KKLAGFSLCLATDINPKACNATRRTATRN-------GARLDSIRCSLADALR-PRSVDVL 113
                 |.:..|    .:||:..||.|::.||..|       .....:::.|..|.:| ...||:|
pombe    67 GILKNKPIVHF----MSDISNSACRASKITALNNRELYKDDNGLFITVQTSFLDGIRLGNGVDIL 127

  Fly   114 LFNPPYVVTSDEELQTQQFDSHSESSTDRNLVFSWAGGQDGRRVTDILLKQLDDILSPRGVLYLL 178
            :||||||.|..||:.       ||::|   :..:||||.||..||..||.||.||||..||.|::
pombe   128 IFNPPYVPTEFEEIP-------SEAAT---IASAWAGGTDGMDVTSTLLNQLKDILSQDGVFYMV 182

  Fly   179 LLRENKPEEIIKYLEGLQFRAVKFMERRIPGEHLCILKVTR 219
            .:..||...|.:.|:...|...:.::|:...|.|.||::.|
pombe   183 AVARNKLHSICEILQKDGFIVNETLKRKAGRETLSILRIYR 223

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HemK2NP_001027221.1 AdoMet_MTases 15..219 CDD:302624 81/221 (37%)
HemK <15..193 CDD:225443 75/195 (38%)
SPAC323.05cNP_594375.1 HemK <10..224 CDD:225443 84/229 (37%)
AdoMet_MTases 17..223 CDD:302624 81/220 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H5637
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003900
OrthoInspector 1 1.000 T1125557
orthoMCL 1 0.900 OOG5_127713
Panther 1 1.100 LDO PTHR45875
Phylome 1 0.910 0.977 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R762
TreeFam 1 0.960
109.910

Return to query results.
Submit another query.