DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: HemK2 and mtq-2

Sequence 1:NP_001027221.1 Gene:HemK2 FlyBaseID:FBgn0031454 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_494209.2 Gene:mtq-2 WormBaseID:WBGene00016341 Length:221 Species:Caenorhabditis elegans

Alignment Length:202 Identity:86/203 (42%)
Similarity:116/203 (57%) Gaps:17/203 (8%)


  Fly    17 VYEPAEDSFLLLDALEKDLEYLDRLQPSLCVELGSGSGVIITALAKKLAGFSLCLATDINPKACN 81
            |||||||:|||:||:|||::.:....|.|.:|:|.||||:.|.:.:.|.|....:|||:||.|.:
 Worm    18 VYEPAEDTFLLIDAIEKDIKEIRSRDPKLVLEIGCGSGVVSTFVNQALGGNVTSVATDLNPHALD 82

  Fly    82 ATRRTATRNGARLDSIRCSLADALRP--RSVDVLLFNPPYVVTSDEELQTQQFDSHSESSTDRNL 144
            .|..||..|..::|.:|..|...|..  ..|||||||||||.| |||.::             |:
 Worm    83 VTLETAKLNDIKIDVVRTDLFAGLENLLGKVDVLLFNPPYVPT-DEEPKS-------------NI 133

  Fly   145 VFSWAGGQDGRRVTDILLKQLDDILSPRGVLYLLLLRENKPEEIIKYLEGLQFRAVKFMERRIPG 209
            ..::|||:.||...|.||.::.::||||||.||:.|..|....::|. ...|......||||...
 Worm   134 ELTYAGGRTGRSTLDRLLPRVPELLSPRGVFYLVALHSNDIPALLKE-HSEQMTVSVSMERRCGI 197

  Fly   210 EHLCILK 216
            |||.|||
 Worm   198 EHLYILK 204

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HemK2NP_001027221.1 AdoMet_MTases 15..219 CDD:302624 86/203 (42%)
HemK <15..193 CDD:225443 75/178 (42%)
mtq-2NP_494209.2 AdoMet_MTases 17..207 CDD:302624 86/203 (42%)
HemK <17..166 CDD:225443 71/162 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C3982014
eggNOG 1 0.900 E1_COG2890
Hieranoid 1 1.000
Homologene 1 1.000 H5637
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003900
OrthoInspector 1 1.000 T475546
orthoMCL 1 0.900 OOG5_127713
Panther 1 1.100 LDO PTHR45875
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R762
TreeFam 1 0.960
1211.740

Return to query results.
Submit another query.