DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: HemK2 and n6amt1

Sequence 1:NP_001027221.1 Gene:HemK2 FlyBaseID:FBgn0031454 Length:224 Species:Drosophila melanogaster
Sequence 2:XP_002941300.1 Gene:n6amt1 XenbaseID:XB-GENE-5899961 Length:215 Species:Xenopus tropicalis

Alignment Length:225 Identity:89/226 (39%)
Similarity:126/226 (56%) Gaps:18/226 (8%)


  Fly     1 METPYTDHLSPEDFEHVYEPAEDSFLLLDALEKDLEYLDRLQPSLCVELGSGSGVIITALAKKLA 65
            :.||...|:....|..||:||||:||||||||||.|.| :.:..:.:|:|.|||| ::|....|.
 Frog     2 LPTPIYPHVGHGIFADVYDPAEDTFLLLDALEKDAEEL-KSRVGISLEVGCGSGV-VSAFIASLI 64

  Fly    66 GFSLC-LATDINPKACNATRRTATRNGARLDSIRCSLADALRPR---SVDVLLFNPPYVVTSDEE 126
            |...| |.|||||.|...|..||..|...::.|...|...|.||   .:|:|:||||||||..||
 Frog    65 GQKACYLCTDINPVAAYCTLETARANQLHIEPIITDLVTGLLPRLQGHIDLLVFNPPYVVTPPEE 129

  Fly   127 LQTQQFDSHSESSTDRNLVFSWAGGQDGRRVTDILLKQLDDILSPRGVLYLLLLRENKPEEIIKY 191
            :.:...::            :||||::||.|.|.....:..:|||.|:.||::|:||.|:||::.
 Frog   130 VGSHGIEA------------AWAGGKNGREVMDRFFPFVPKLLSPTGIFYLIVLKENNPDEILEN 182

  Fly   192 LEGLQFRAVKFMERRIPGEHLCILKVTRYL 221
            :........|.:.|:...|:||:||..|.|
 Frog   183 MRMYGLIGSKVLCRQAGRENLCVLKFCRLL 212

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HemK2NP_001027221.1 AdoMet_MTases 15..219 CDD:302624 83/208 (40%)
HemK <15..193 CDD:225443 76/182 (42%)
n6amt1XP_002941300.1 AdoMet_MTases 17..208 CDD:302624 83/205 (40%)
HemK <17..181 CDD:225443 76/178 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H5637
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003900
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.