| Sequence 1: | NP_001027221.1 | Gene: | HemK2 / 3771966 | FlyBaseID: | FBgn0031454 | Length: | 224 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_002941300.2 | Gene: | n6amt1 / 100380133 | XenbaseID: | XB-GENE-5899961 | Length: | 215 | Species: | Xenopus tropicalis | 
| Alignment Length: | 224 | Identity: | 86/224 - (38%) | 
|---|---|---|---|
| Similarity: | 125/224 - (55%) | Gaps: | 16/224 - (7%) | 
- Green bases have known domain annotations that are detailed below.
| 
 
  Fly     1 METPYTDHLSPEDFEHVYEPAEDSFLLLDALEKDLEYLDRLQPSLCVELGSGSGVIITALAKKLA 65 
  Fly    66 GFSLCLATDINPKACNATRRTATRNGARLDSIRCSLADALRPR---SVDVLLFNPPYVVTSDEEL 127 
  Fly   128 QTQQFDSHSESSTDRNLVFSWAGGQDGRRVTDILLKQLDDILSPRGVLYLLLLRENKPEEIIKYL 192 
  Fly   193 EGLQFRAVKFMERRIPGEHLCILKVTRYL 221  | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| HemK2 | NP_001027221.1 | AdoMet_MTases | 15..219 | CDD:302624 | 80/206 (39%) | 
| HemK | <15..193 | CDD:225443 | 73/180 (41%) | ||
| n6amt1 | XP_002941300.2 | AdoMet_MTases | 17..208 | CDD:418430 | 79/203 (39%) | 
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 1 | 1.000 | 69 | 1.000 | Domainoid score | I9541 | 
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 1 | 1.000 | - | - | ||
| Homologene | 1 | 1.000 | - | - | H5637 | |
| Inparanoid | 1 | 1.050 | 145 | 1.000 | Inparanoid score | I4330 | 
| OMA | 1 | 1.010 | - | - | QHG54278 | |
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 1 | 1.000 | - | - | FOG0004328 | |
| OrthoInspector | 1 | 1.000 | - | - | oto104824 | |
| Panther | 1 | 1.100 | - | - | LDO | PTHR45875 | 
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 1 | 1.000 | - | - | X3597 | |
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 10 | 10.070 | |||||