DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gr64e and Gr5a

Sequence 1:NP_001027106.1 Gene:Gr64e FlyBaseID:FBgn0045476 Length:460 Species:Drosophila melanogaster
Sequence 2:NP_511050.1 Gene:Gr5a FlyBaseID:FBgn0003747 Length:444 Species:Drosophila melanogaster

Alignment Length:416 Identity:157/417 (38%)
Similarity:256/417 (61%) Gaps:9/417 (2%)


  Fly    49 LSLIKAWLLRIRQ-------EDYKYSGSFQEAIKPVLIIAQIFALMPVRKVSSKFAEDLTFTWFS 106
            |..:|:.|.:||:       :::.:.|||.||:.|||.:||.|.||||..:|:.....|:|...|
  Fly    25 LKNLKSGLEQIRESQVRGTRKNFLHDGSFHEAVAPVLAVAQCFCLMPVCGISAPTYRGLSFNRRS 89

  Fly   107 VRSYYALVTILFFGVSSGYMVAFVTSVSFNFDSVETLVFYLSIFLISLSFFQLARKWPEIAQSWQ 171
            .|.:|:.:.:....|...:.:..|.....:..|||.:||::||.:.|..|..||:.||.:.:.|.
  Fly    90 WRFWYSSLYLCSTSVDLAFSIRRVAHSVLDVRSVEPIVFHVSILIASWQFLNLAQLWPGLMRHWA 154

  Fly   172 LVEAKLPPLKLPKERRSLAQHINMITIVATTCSLVEHIMSMLSMGYYVNSCPRWPDRPIDSFLYL 236
            .||.:||......:|...|:.:.::..|....||:||::|::|:.|| :.|||..| |::|:|..
  Fly   155 AVERRLPGYTCCLQRARPARRLKLVAFVLLVVSLMEHLLSIISVVYY-DFCPRRSD-PVESYLLG 217

  Fly   237 SFSSVFYFVDYTRFLGIVGKVVNVLSTFAWNFNDIFVMAVSVALAARFRQLNDYMMREARLPTTV 301
            :.:.:|....|:.:|..:||:.|||.||.|::.|||:|.:.:.|:....:||..:.::.|.|...
  Fly   218 ASAQLFEVFPYSNWLAWLGKIQNVLLTFGWSYMDIFLMMLGMGLSEMLARLNRSLEQQVRQPMPE 282

  Fly   302 DYWMQCRINFRNLCKLCEEVDDAISTITLLCFSNNLYFICGKILKSMQAKPSIWHALYFWFSLVY 366
            .||...|..:|::.:|..|||||:|.|.|:.|.:||||||.::|||:...||..||:||:|||::
  Fly   283 AYWTWSRTLYRSIVELIREVDDAVSGIMLISFGSNLYFICLQLLKSINTMPSSAHAVYFYFSLLF 347

  Fly   367 LLGRTLILSLYSSSINDESKRPLVIFRLVPREYWCDELKRFSEEVQMDNVALTGMKFFRLTRGVV 431
            ||.|:..:.|:.|:|||:::.||.:.||||.:.:..|:.||:.|:..|.|||||:|||.:||.:.
  Fly   348 LLSRSTAVLLFVSAINDQAREPLRLLRLVPLKGYHPEVFRFAAELASDQVALTGLKFFNVTRKLF 412

  Fly   432 ISVAGTIVTYELILLQFNGEEKVPGC 457
            :::|||:.||||:|:||:.::|...|
  Fly   413 LAMAGTVATYELVLIQFHEDKKTWDC 438

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Gr64eNP_001027106.1 Trehalose_recp 58..458 CDD:253587 154/408 (38%)
Gr5aNP_511050.1 7tm_7 46..437 CDD:303125 151/393 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131090008
eggNOG 1 0.900 E1_28M3V
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005347
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21421
RoundUp 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.