DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gr64e and Gr61a

Sequence 1:NP_001027106.1 Gene:Gr64e FlyBaseID:FBgn0045476 Length:460 Species:Drosophila melanogaster
Sequence 2:NP_001261226.1 Gene:Gr61a FlyBaseID:FBgn0035167 Length:436 Species:Drosophila melanogaster

Alignment Length:444 Identity:133/445 (30%)
Similarity:222/445 (50%) Gaps:33/445 (7%)


  Fly    24 SRVGSDATLGIIKYRVVEKDTKRFKLSLIKAWLLRIRQEDYKYSGSFQEAIKPVLIIAQIFALMP 88
            ||...|    |.|:..|.:..:|..|::  .|.......:::...:|..||:|.|.:||.|.:||
  Fly     2 SRTSDD----IRKHLKVRRQKQRAILAM--RWRCAQGGLEFEQLDTFYGAIRPYLCVAQFFGIMP 60

  Fly    89 VRKVSSKFAEDLTFTWFSVRSYYALVTILFF---GVSS--GYMVAFVTSVSFNFDSVETLVFYLS 148
            :..:.|:..:|:.   |.|||....||.||.   |:.:  |..:.|...:  |..::..|||.:.
  Fly    61 LSNIRSRDPQDVK---FKVRSIGLAVTGLFLLLGGMKTLVGANILFTEGL--NAKNIVGLVFLIV 120

  Fly   149 IFLISLSFFQLARKWPEIAQSWQLVEAKL--PPLKLPKERRSLAQHINMITIVATTCSLVEHIMS 211
            ..:..|:|...||.|..|...|..|:..:  ||.|  :.:|||...:|::.:.....::.:|::.
  Fly   121 GMVNWLNFVGFARSWSHIMLPWSSVDILMLFPPYK--RGKRSLRSKVNVLALSVVVLAVGDHMLY 183

  Fly   212 MLSMGY-----YVNSCPRWPDRPIDSFLYL--SFSSVFYFVDYTRFLGIVGKVVNVLSTFAWNFN 269
            ..| ||     ::..|.....| |...|||  .||.:.:.:.:..|....|..:|...||.|||.
  Fly   184 YAS-GYCSYSMHILQCHTNHSR-ITFGLYLEKEFSDIMFIMPFNIFSMCYGFWLNGAFTFLWNFM 246

  Fly   270 DIFVMAVSVALAARFRQLNDYM--MREARLPTTVDYWMQCRINFRNLCKLCEEVDDAISTITLLC 332
            |||::..|:.||.||:|....:  :....:|..:  |...|.:...||:|...|:.::|.|..:.
  Fly   247 DIFIVMTSIGLAQRFQQFAARVGALEGRHVPEAL--WYDIRRDHIRLCELASLVEASMSNIVFVS 309

  Fly   333 FSNNLYFICGKILKSMQAKPSIWHALYFWFSLVYLLGRTLILSLYSSSINDESKRPLVIFRLVPR 397
            .:||:|.||.:.|..........:.:|||:||::||.||.::.:.:|.|:|.|..||....|||.
  Fly   310 CANNVYVICNQALAIFTKLRHPINYVYFWYSLIFLLARTSLVFMTASKIHDASLLPLRSLYLVPS 374

  Fly   398 EYWCDELKRFSEEVQMDNVALTGMKFFRLTRGVVISVAGTIVTYELILLQFNGE 451
            :.|..|::||::::..:.|.|:|.:.|.|||..:..:..|:|||||:|||.:.:
  Fly   375 DGWTQEVQRFADQLTSEFVGLSGYRLFCLTRKSLFGMLATLVTYELMLLQIDAK 428

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Gr64eNP_001027106.1 Trehalose_recp 58..458 CDD:253587 124/411 (30%)
Gr61aNP_001261226.1 Trehalose_recp 1..434 CDD:253587 133/445 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131090077
eggNOG 1 0.900 E1_28M3V
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005347
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21421
RoundUp 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.