DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gr64e and Gr64d

Sequence 1:NP_001027106.1 Gene:Gr64e FlyBaseID:FBgn0045476 Length:460 Species:Drosophila melanogaster
Sequence 2:NP_001027105.2 Gene:Gr64d FlyBaseID:FBgn0035486 Length:417 Species:Drosophila melanogaster

Alignment Length:413 Identity:122/414 (29%)
Similarity:204/414 (49%) Gaps:58/414 (14%)


  Fly    69 SFQE-----AIKPVLIIAQIFALMPVRKVS-SKFAEDLTFTWFSVRSYYALVTILFFGVSSGYMV 127
            |.||     .|..|||||:||.::|:..:: :...|::.|.|||  .|     ||||.|:..:::
  Fly     4 SVQENTLHYTIGHVLIIARIFGVLPLAGINPNGKPENVRFRWFS--PY-----ILFFVVAFTFVI 61

  Fly   128 A-FVTSVSFNFDSVETLVFY----LSIFLISL----SFFQLARKWPEIAQSWQLVE-AKLPPLKL 182
            | |:.|.....:  :.|..|    ||..:|.:    ||.:|:|:||.|.:...|.| ..|.|...
  Fly    62 ADFMLSTKIVLN--DGLQLYTMGSLSFSVICIFCFGSFIKLSRRWPHIIRETALCERIFLKPCYA 124

  Fly   183 PKERRSLAQHINMITIVATTCSLVEHIMSM---------------LSMGYYVNSCPRWPDRPIDS 232
            .:|..:..:.:....::....:|.||:..:               |.:|:..|...|........
  Fly   125 NQEGLNFTRFLRRWALILLVAALCEHLTYVGSAAWSNYVQIRDCNLKVGFVENYFLRERQELFSV 189

  Fly   233 FLYLSFSSVFYFVDYTRFLGIVGKVVNVLSTFAWNFNDIFVMAVSVALAARFRQLNDYMMREARL 297
            |.|.::  :.:|:::.          .:..||.|||.|||:..:...|..||:||:..:.:....
  Fly   190 FEYRAW--MVFFIEWN----------TMAMTFVWNFGDIFLFLMCRGLKIRFQQLHWRIRQNLGK 242

  Fly   298 PTTVDYWMQCRINFRNLCKLCEEVDDAISTITLLCFSNNLYFICGKILKSMQAKPSIWHALYFWF 362
            |...::|.:.|.:|.:|..|.:..|..:|.:.|:|.::|:||||.::..|.|.|.:....|||||
  Fly   243 PMAKEFWQEIRSDFLDLDSLLKLYDKELSGLILVCCAHNMYFICVQVYHSFQVKGAFMDELYFWF 307

  Fly   363 SLVYLLGRTLILSLYSSSINDESK---RPLVIFRLVPREYWCDELKRFSEEVQMDNVALTGMKFF 424
            .|:|::.|.:.:.|.:|||..|.|   ..|...|..|   |||||.|.||.::.:..||:||.:|
  Fly   308 CLLYVISRLMNMMLAASSIPQEIKDISNTLYEVRSSP---WCDELGRLSEMLRNETFALSGMGYF 369

  Fly   425 RLTRGVVISVAGTIVTYELILLQ 447
            .:||.::.::||.::.|||:|.:
  Fly   370 YVTRRLIFAMAGALMGYELVLFR 392

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Gr64eNP_001027106.1 Trehalose_recp 58..458 CDD:253587 122/414 (29%)
Gr64dNP_001027105.2 Trehalose_recp 1..404 CDD:253587 122/414 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131090437
eggNOG 1 0.900 E1_28M3V
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005347
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21421
RoundUp 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.