DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr64e and LOC1269163

DIOPT Version :10

Sequence 1:NP_001027106.1 Gene:Gr64e / 3771916 FlyBaseID:FBgn0045476 Length:460 Species:Drosophila melanogaster
Sequence 2:XP_307762.4 Gene:LOC1269163 / 1269163 VectorBaseID:AGAMI1_005920 Length:182 Species:Anopheles gambiae


Alignment Length:181 Identity:47/181 - (25%)
Similarity:92/181 - (50%) Gaps:3/181 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 WQLVEAKLPPL-KLPKERRSLAQHINMITIVATTCSLVEHIMSMLSMGYYVNSCPRWPDRPIDSF 233
            |..:|..||.. :|....|..|:.:.::..|..|..|:||::|..:..:....|| .|:. :::.
Mosquito     4 WVQLEQSLPDQPRLSAACRRNARQVGLVATVLLTSGLIEHVLSKPAGLHRAYRCP-IPNL-LEAH 66

  Fly   234 LYLSFSSVFYFVDYTRFLGIVGKVVNVLSTFAWNFNDIFVMAVSVALAARFRQLNDYMMREARLP 298
            ...:|..:|.||.|..::|.:.:.:..|.|..||:.|:|:::|||.|.....|:||.:....:|.
Mosquito    67 YKQAFPEMFSFVPYNPYIGFLAQTITSLLTVYWNYVDLFLISVSVGLRTNLAQVNDVIASSEKLY 131

  Fly   299 TTVDYWMQCRINFRNLCKLCEEVDDAISTITLLCFSNNLYFICGKILKSMQ 349
            ....:|.....::|.:..|...|::.|....::.:::||:|||.:::...|
Mosquito   132 HRGIFWKDQCTHYRRVLGLIRHVNNHIGVFIVISYASNLFFICVQLVNVFQ 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr64eNP_001027106.1 mt-LAF21-like <10..>62 CDD:467860
Trehalose_recp 57..458 CDD:336318 47/181 (26%)
LOC1269163XP_307762.4 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.