DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gr64e and Gr64b

Sequence 1:NP_001027106.1 Gene:Gr64e FlyBaseID:FBgn0045476 Length:460 Species:Drosophila melanogaster
Sequence 2:NP_728921.1 Gene:Gr64b FlyBaseID:FBgn0045478 Length:406 Species:Drosophila melanogaster

Alignment Length:413 Identity:126/414 (30%)
Similarity:204/414 (49%) Gaps:35/414 (8%)


  Fly    69 SFQEAIKPVLIIAQIFALMPVRKVSSKFAEDLTFTWFSVRSYYALVTILFFGVSSGYMVAFVTSV 133
            :|..|:..||.|:||:.|:||..|.:....|:.|.|.|.|..|:|:..:......|.::.:|..|
  Fly     6 TFHRAVSNVLFISQIYGLLPVSNVRALDVADIRFRWCSPRILYSLLIGILNLSEFGAVINYVIKV 70

  Fly   134 SFNFDSVETLVFYLSIFLISLSFFQLARKWPEIAQSWQLVEAKL--PPLKLPKERRSLAQHINMI 196
            :.||.:..||..|:...|..|.|::||.:||.|.::|..||...  .|.:...|.| :.:.|.::
  Fly    71 TINFHTSSTLSLYIVCLLEHLFFWRLAIQWPRIMRTWHGVEQLFLRVPYRFYGEYR-IKRRIYIV 134

  Fly   197 TIVATTCSLVEHIMSMLSMGY---------------YVNSCPRWPDRPIDSFLYLSFSSVFYFVD 246
            ..:..:.:||||.: :|...:               |..|..:| :||   .||:.....|:.:.
  Fly   135 FTIVMSSALVEHCL-LLGNSFHLSNMERTQCKINVTYFESIYKW-ERP---HLYMILPYHFWMLP 194

  Fly   247 YTRFLGIVGKVVNVLSTFAWNFNDIFVMAVSVALAARFRQLNDYMMREARLPTTVDYWMQCRINF 311
            ...:       ||....:..:|.|.|:|.:.:.|||||.||...:....|......:|.:.|.::
  Fly   195 ILEW-------VNQTIAYPRSFTDCFIMCIGIGLAARFHQLYRRIAAVHRKVMPAVFWTEVREHY 252

  Fly   312 RNLCKLCEEVDDAISTITLLCFSNNLYFICGKILKSMQ-AKPSIWHALYFWFSLVYLLGRTLILS 375
            ..|.:|...:|.||:.:.||.|.||:.|||.::..|.: ........|.||:||.:.:.|||:..
  Fly   253 LALKRLVHLLDAAIAPLVLLAFGNNMSFICFQLFNSFKNIGVDFLVMLAFWYSLGFAVVRTLLTI 317

  Fly   376 LYSSSINDESKRPLVIFRLVPREYWCDELKRFSEEVQMDNVALTGMKFFRLTRGVVISVAGTIVT 440
            ..:|||||..::.:...|.||...|..|::||||::..|..||:|..||.|||.:|:::..||:|
  Fly   318 FVASSINDYERKIVTALRDVPSRAWSIEVQRFSEQLGNDTTALSGSGFFYLTRSLVLAMGTTIIT 382

  Fly   441 YEL----ILLQFNGEEKVPGCFE 459
            |||    ::.|.:..:|...|.|
  Fly   383 YELMISDVINQGSIRQKTQYCRE 405

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Gr64eNP_001027106.1 Trehalose_recp 58..458 CDD:253587 125/411 (30%)
Gr64bNP_728921.1 Trehalose_recp 3..400 CDD:253587 124/407 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131090295
eggNOG 1 0.900 E1_28M3V
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005347
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21421
RoundUp 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.