DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gr64e and Gr64c

Sequence 1:NP_001027106.1 Gene:Gr64e FlyBaseID:FBgn0045476 Length:460 Species:Drosophila melanogaster
Sequence 2:NP_001246610.1 Gene:Gr64c FlyBaseID:FBgn0045477 Length:419 Species:Drosophila melanogaster

Alignment Length:417 Identity:117/418 (28%)
Similarity:199/418 (48%) Gaps:60/418 (14%)


  Fly    69 SFQEAIKPVLIIAQIFALMPVRKV-SSKFAEDLTFTWFSVRSYYALVTILF----FGVSS----- 123
            :.|.||.|||:|||.|.::||..| .|...|.:.|.|.|:....||:..:|    ..:||     
  Fly    12 TLQHAIGPVLVIAQFFGVLPVAGVWPSCRPERVRFRWISLSLLAALILFVFSIVDCALSSKVVFD 76

  Fly   124 -GYMVAFVTSVSFNFDSVETLVFYLSIFLISLSFFQLARKWPEIAQSWQLVEAKLPPLKLPKE-- 185
             |..:..:.|:||:.    ..:|...:||:      |:|:||.|.:.    .|:...:.|..|  
  Fly    77 HGLKIYTIGSLSFSV----ICIFCFGVFLL------LSRRWPYIIRR----TAECEQIFLEPEYD 127

  Fly   186 ---RRSLAQHINMITIVATTCSLVEH---------------IMSMLSMGYYVNSCPRWPDRPIDS 232
               .|..:..:.:..:.....:|.||               :...|...::.|...|  :|. ..
  Fly   128 CSYGRGYSSRLRLWGVCMLVAALCEHSTYVGSALYNNHLAIVECKLDANFWQNYFQR--ERQ-QL 189

  Fly   233 FLYLSFSSVFY-FVDYTRFLGIVGKVVNVLSTFAWNFNDIFVMAVSVALAARFRQLNDYMMREAR 296
            ||.:.|::.:. |:::|          .:..||.|||.|||::.:...:..||:|::..:.:..|
  Fly   190 FLIMHFTAWWIPFIEWT----------TLSMTFVWNFVDIFLILICRGMQMRFQQMHWRIRQHVR 244

  Fly   297 LPTTVDYWMQCRINFRNLCKLCEEVDDAISTITLLCFSNNLYFICGKILKSMQAKPSIWHALYFW 361
            .....::|.:.|.:..:|..|....|..:|.:.:|..::|:||:|.:|..|.|:|.:....||||
  Fly   245 QQMPNEFWQRIRCDLLDLSDLLGIYDKELSGLIVLSCAHNMYFVCVQIYHSFQSKGNYADELYFW 309

  Fly   362 FSLVYLLGRTLILSLYSSSINDESKRPLVIFRLVPREYWCDELKRFSEEVQMDNVALTGMKFFRL 426
            |.|.|::.|.|.:...:|||..|:|........:|.|:||.||:|.:|....|:.||:|..:|.|
  Fly   310 FCLSYVIIRVLNMMFAASSIPQEAKEISYTLYEIPTEFWCVELRRLNEIFLSDHFALSGKGYFLL 374

  Fly   427 TRGVVISVAGTIVTYELILL-QFNGEE 452
            ||.::.::|.|::.|||:|: |..|.|
  Fly   375 TRRLIFAMAATLMVYELVLINQMAGSE 401

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Gr64eNP_001027106.1 Trehalose_recp 58..458 CDD:253587 117/418 (28%)
Gr64cNP_001246610.1 Trehalose_recp 1..407 CDD:253587 117/418 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131090598
eggNOG 1 0.900 E1_28M3V
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005347
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21421
RoundUp 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.