DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gr64e and Gr64f

Sequence 1:NP_001027106.1 Gene:Gr64e FlyBaseID:FBgn0045476 Length:460 Species:Drosophila melanogaster
Sequence 2:NP_728924.2 Gene:Gr64f FlyBaseID:FBgn0052255 Length:469 Species:Drosophila melanogaster

Alignment Length:402 Identity:176/403 (44%)
Similarity:264/403 (66%) Gaps:1/403 (0%)


  Fly    56 LLRIRQEDYKYSGSFQEAIKPVLIIAQIFALMPVRKVSSKFAEDLTFTWFSVRSYYALVTILFFG 120
            |.|..:|.:...|||.:|:..||::|:.||:|||:.|:.|...||:|:|.::|:.::|:.|....
  Fly    63 LSRSDKEAFLSDGSFHQAVGRVLLVAEFFAMMPVKGVTGKHPSDLSFSWRNIRTCFSLLFIASSL 127

  Fly   121 VSSGYMVAFVTSVSFNFDSVETLVFYLSIFLISLSFFQLARKWPEIAQSWQLVEAKLPPLKLPKE 185
            .:.|..:..|.:...:|:|::.::|..|:.|:.:....|||:||::...|..||..||..|....
  Fly   128 ANFGLSLFKVLNNPISFNSIKPIIFRGSVLLVLIVALNLARQWPQLMMYWHTVEKDLPQYKTQLT 192

  Fly   186 RRSLAQHINMITIVATTCSLVEHIMSMLSMGYYVNSCPRWPDRPIDSFLYLSFSSVFYFVDYTRF 250
            :..:...|:|:.::....|..|||:||:|...|.:.|.|..| ||.::...:...:|:...|:..
  Fly   193 KWKMGHTISMVMLLGMMLSFAEHILSMVSAINYASFCNRTAD-PIQNYFLRTNDEIFFVTSYSTT 256

  Fly   251 LGIVGKVVNVLSTFAWNFNDIFVMAVSVALAARFRQLNDYMMREARLPTTVDYWMQCRINFRNLC 315
            |.:.||..||.|||.||:.|:|||.||:.||::||||||.:.....:.....||.:.||.:||:|
  Fly   257 LALWGKFQNVFSTFIWNYMDLFVMIVSIGLASKFRQLNDDLRNFKGMNMAPSYWSERRIQYRNIC 321

  Fly   316 KLCEEVDDAISTITLLCFSNNLYFICGKILKSMQAKPSIWHALYFWFSLVYLLGRTLILSLYSSS 380
            .||:::|||||.||::.|||||||||.::|:|:...||:.||:||:|||::|:||||.:||||||
  Fly   322 ILCDKMDDAISLITMVSFSNNLYFICVQLLRSLNTMPSVAHAVYFYFSLIFLIGRTLAVSLYSSS 386

  Fly   381 INDESKRPLVIFRLVPREYWCDELKRFSEEVQMDNVALTGMKFFRLTRGVVISVAGTIVTYELIL 445
            ::|||:..|...|.||:|.||.|:|||:|||..|.|||||||||.|||.:|:|||||||||||:|
  Fly   387 VHDESRLTLRYLRCVPKESWCPEVKRFTEEVISDEVALTGMKFFHLTRKLVLSVAGTIVTYELVL 451

  Fly   446 LQFNGEEKVPGC 457
            :||:.:..:..|
  Fly   452 IQFHEDNDLWDC 463

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Gr64eNP_001027106.1 Trehalose_recp 58..458 CDD:253587 175/401 (44%)
Gr64fNP_728924.2 Trehalose_recp 56..462 CDD:253587 175/400 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131089986
eggNOG 1 0.900 E1_28M3V
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005347
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21421
RoundUp 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.