DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG43736 and AT1G15790

Sequence 1:NP_001259298.1 Gene:CG43736 FlyBaseID:FBgn0263993 Length:1367 Species:Drosophila melanogaster
Sequence 2:NP_001322877.1 Gene:AT1G15790 AraportID:AT1G15790 Length:189 Species:Arabidopsis thaliana

Alignment Length:109 Identity:26/110 (24%)
Similarity:45/110 (41%) Gaps:22/110 (20%)


  Fly    38 RPDDA-EIRELAAKMKEQQKQQAAQQAS--RQAAMQHSN-----GGAIAASSAGGNM-----QPP 89
            ||:.. |:|::|.:.:|:....|:.|..  ||..|:..|     ..|..:|||..|.     :|.
plant    35 RPEGTNELRKIAVRFEEKLFNNASNQTEYLRQICMKMLNMETKSQNAAGSSSADDNTPPLVPEPS 99

  Fly    90 ITNGNGQTNIMNYLSR-----HQKLPNGTM----QVVPALASNG 124
            :.|.....|..::.::     .||..|..:    ::||.....|
plant   100 VPNNEPAVNTGDWRTQQPQDSRQKNINALLDTLKKIVPHSGKEG 143



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR33137
Phylome 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.