DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG43736 and NRB4

Sequence 1:NP_001259298.1 Gene:CG43736 FlyBaseID:FBgn0263993 Length:1367 Species:Drosophila melanogaster
Sequence 2:NP_001321151.1 Gene:NRB4 AraportID:AT1G15780 Length:1366 Species:Arabidopsis thaliana

Alignment Length:968 Identity:202/969 (21%)
Similarity:321/969 (33%) Gaps:256/969 (26%)


  Fly   351 NGTEFEDYWPSKVVDSNLLIGNRANVNNSVNWTRQPSAPPPKVT-----TSVSGSSG-------- 402
            |||.. |..|:.  ...||.|:.:        |.|..||.|.::     .:.||.:|        
plant   108 NGTSI-DSIPTN--QGQLLPGSLS--------TNQSQAPQPLLSQTMQNNTASGMTGSTALPSSM 161

  Fly   403 -PSSSSGGNMGQNTSAASSSANTAGGQQVTSKSQQQHAASA---------------AAAAATAHQ 451
             |.||...|  ..||..:.:||......:...|..||..|:               |.::....|
plant   162 PPVSSITNN--NTTSVVNQNANMQNVAGMLQDSSGQHGLSSNMFSGPQRQMLGRPHAMSSQQQQQ 224

  Fly   452 QHLMKQRAAAAAAAAGANGVANAANSFGAAAVAAFNSQAAAAASMLQQSQGN----NRMLS---- 508
            .:|.:|:.....          ...:|.:..|...||   ...|.:||.|.|    |::.|    
plant   225 PYLYQQQLQQQL----------LKQNFQSGNVPNPNS---LLPSHIQQQQQNVLQPNQLHSSQQP 276

  Fly   509 ----QATVQALASSGWMSG-QTNLQLHAQMMAQQTHAN---ANRVGSYREHMNNLMMSGSSRQPY 565
                .||..:..:|..:.| .||.|...|:.:|||..:   .::....|:|..:...||..:|..
plant   277 GVPTSATQPSTVNSAPLQGLHTNQQSSPQLSSQQTTQSMLRQHQSSMLRQHPQSQQASGIHQQQS 341

  Fly   566 SYNNPAISMSSVNNHSGGGGNAPPPLVRSAAGQNANHMSNVEQSMVQQQQQQTQQQPQQQQRHQN 630
            |.  |..|:|.:...       |..|:|    |.|.:.|.::|..:..|......|.|.|||..|
plant   342 SL--PQQSISPLQQQ-------PTQLMR----QQAANSSGIQQKQMMGQHVVGDMQQQHQQRLLN 393

  Fly   631 STFNNNNNHAPQQHSSPNNQTNSSHHHHHQQQQQQQP---QHALAKSLSSNNNNNNSSSNNSNCS 692
            ...|..|....|....|..|.        ||||:|||   |..:::..|....:.|.....||.:
plant   394 QQNNVMNIQQQQSQQQPLQQP--------QQQQKQQPPAQQQLMSQQNSLQATHQNPLGTQSNVA 450

  Fly   693 S---------NNNMRNSNSSNNSSSAAAVAAAAAAGYVQALLGGGGGAGGVAGGAGAGSNAFNYN 748
            .         |:.:.||:..||..|...::.....  :|.....|.|.....|.......:....
plant   451 GLQQPQQQMLNSQVGNSSLQNNQHSVHMLSQPTVG--LQRTHQAGHGLYSSQGQQSQNQPSQQQM 513

  Fly   749 LPSTRADYTNLALWNQLTP-------AQRLLISQQLKGA--TPTGSGGNITSGTASSHAAGKQNF 804
            :|..::.:..|.|..|  |       .|||..|.|:.|:  .|.    |:.......:.: ::..
plant   514 MPQLQSHHQQLGLQQQ--PNLLQQDVQQRLQASGQVTGSLLPPQ----NVVDQQRQLYQS-QRTL 571

  Fly   805 PALPSLPLDTDLITMLDYNNPNKANKSQKSAGGVTFTKPIVPPL-------IPDGSGAEITLTKS 862
            |.:||..||:...|              :||.|..:.:.:...:       :||       |.:.
plant   572 PEMPSSSLDSTAQT--------------ESANGGDWQEEVYQKIKSMKETYLPD-------LNEI 615

  Fly   863 RRAGGGGGVDGGGGGGGAGGGGGGGVAATGNGTTIP----------------------------- 898
            .:.                      |||.....::|                             
plant   616 YQR----------------------VAAKLQQDSMPQQQRSDQLEKLRQFKTMLERMIQFLSVSK 658

  Fly   899 LNSTQALED----FEKK---FTVMTDEMRAVIQKVLANPDLSTFIQTNSNS-NNSANQNHLVPSY 955
            .|...||:|    :||:   |..|....:.|.|..|....:....|..|.: .:.::.|...|..
plant   659 SNIMPALKDKVAYYEKQIIGFLNMHRPRKPVQQGQLPQSQMQPMQQPQSQTVQDQSHDNQTNPQM 723

  Fly   956 ISPPMSPSVGGLNMGMAMSNVATLTLASNPNVTITPQLPGHFLHSPSSSCSSSSASNTAPSPLSS 1020
            .|..|. ..|......:|:|:.:..|:|.|.|:...|      :.|||..:||         |.|
plant   724 QSMSMQ-GAGPRAQQSSMTNMQSNVLSSRPGVSAPQQ------NIPSSIPASS---------LES 772

  Fly  1021 GGGGVGGSGGAGGAAGGASSGATGRQKSVICSTKSNNLPLAILSLASNNSGGVSSNSGVRRNNNN 1085
            |.|....:|..      .:.|:..:..|.:.:..|.:....:.:|.||.:....|:|.::..:..
plant   773 GQGNTLNNGQQ------VAMGSMQQNTSQLVNNSSASAQSGLSTLQSNVNQPQLSSSLLQHQHLK 831

  Fly  1086 TNSNYGRQTHSQSSSNHSNTQTTSTQQQSTP---------------TDVIDLSSSRRSLAASAAY 1135
            ...:...|...|........|....:||...               .|:.|| :||:.:..|...
plant   832 QQQDQQMQLKQQFQQRQMQQQQLQARQQQQQQQLQARQQAAQLQQMNDMNDL-TSRQGMNVSRGM 895

  Fly  1136 LQQHS-----SAVAQQQVAAAAVAQQQRLAAVAAHHAQQNGRSSSNSGNAGNSANASG 1188
            .||||     :....||:...||:..|.|...:...:|.    .|...:..|:.|..|
plant   896 FQQHSMQGQRANYPLQQLKPGAVSSPQLLQGASPQMSQH----LSPQVDQKNTVNKMG 949



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR33137
Phylome 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.