DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43736 and F30F8.5

DIOPT Version :9

Sequence 1:NP_001259298.1 Gene:CG43736 / 3771905 FlyBaseID:FBgn0263993 Length:1367 Species:Drosophila melanogaster
Sequence 2:NP_001122469.1 Gene:F30F8.5 / 185130 WormBaseID:WBGene00009274 Length:271 Species:Caenorhabditis elegans


Alignment Length:221 Identity:50/221 - (22%)
Similarity:85/221 - (38%) Gaps:47/221 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 DAEIRELAAKMKEQQKQQAAQQASRQAAMQHSNGGAIAASSAGGNMQPPITNGNGQTNIMNYLSR 105
            |.|:.:......|:|......:      .|.:|..:...:.:..|:.||                
 Worm    29 DVEVIKSDCSTPEKQNGAVGNE------QQMNNSTSTRRTDSNKNLSPP---------------- 71

  Fly   106 HQKLPNGTMQVVPALASNGRSNGAVSDSGSDKKSSTGPCDEESIQGHFGWAQFGKVSIPYIYRQS 170
            .|:|               |::.:.||...:..||....|         |.....:.:|.:.|..
 Worm    72 PQRL---------------RTSSSTSDGTENLISSLSSWD---------WVTIDGLKLPAVTRNK 112

  Fly   171 EKYCSVRMIELKLLGKYLNCLHPDIYSSCTCVRSYYITDAEARLFIEINHKHCDGEFGRDIFNQK 235
            |:|.:|.|::||||.|:.:.:..||....| :.|:.:|..||..|..||......:.|..:|...
 Worm   113 ERYVAVHMVQLKLLSKFPSDIPRDITRKFT-MGSHKMTVTEAWTFNTINAVIRKFDLGCQLFTAN 176

  Fly   236 DLVVRLSDASKFYQFLDICYRKLVSG 261
            |.:|:|:|...||..:.:...|.|:|
 Worm   177 DELVKLNDVQMFYWNVKLFNLKRVNG 202



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0012749
OrthoInspector 1 1.000 - - oto17407
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R17093
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.