DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG43736 and F30F8.5

Sequence 1:NP_001259298.1 Gene:CG43736 FlyBaseID:FBgn0263993 Length:1367 Species:Drosophila melanogaster
Sequence 2:NP_001122469.1 Gene:F30F8.5 WormBaseID:WBGene00009274 Length:271 Species:Caenorhabditis elegans

Alignment Length:221 Identity:50/222 (23%)
Similarity:85/222 (38%) Gaps:47/222 (21%)


  Fly    41 DAEIRELAAKMKEQQKQQAAQQASRQAAMQHSNGGAIAASSAGGNMQPPITNGNGQTNIMNYLSR 105
            |.|:.:......|:|......:      .|.:|..:...:.:..|:.||                
 Worm    29 DVEVIKSDCSTPEKQNGAVGNE------QQMNNSTSTRRTDSNKNLSPP---------------- 71

  Fly   106 HQKLPNGTMQVVPALASNGRSNGAVSDSGSDKKSSTGPCDEESIQGHFGWAQFGKVSIPYIYRQS 170
            .|:|               |::.:.||...:..||....|         |.....:.:|.:.|..
 Worm    72 PQRL---------------RTSSSTSDGTENLISSLSSWD---------WVTIDGLKLPAVTRNK 112

  Fly   171 EKYCSVRMIELKLLGKYLNCLHPDIYSSCTCVRSYYITDAEARLFIEINHKHCDGEFGRDIFNQK 235
            |:|.:|.|::||||.|:.:.:..||....| :.|:.:|..||..|..||......:.|..:|...
 Worm   113 ERYVAVHMVQLKLLSKFPSDIPRDITRKFT-MGSHKMTVTEAWTFNTINAVIRKFDLGCQLFTAN 176

  Fly   236 DLVVRLSDASKFYQFLDICYRKLVSG 261
            |.:|:|:|...||..:.:...|.|:|
 Worm   177 DELVKLNDVQMFYWNVKLFNLKRVNG 202



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28NJW
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0013822
OrthoInspector 1 1.000 T474872
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R17093
TreeFam 1 0.960
54.890

Return to query results.
Submit another query.