DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33654 and CG33632

DIOPT Version :10

Sequence 1:NP_001027165.1 Gene:CG33654 / 3771825 FlyBaseID:FBgn0053654 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_001036537.1 Gene:CG33632 / 3885590 FlyBaseID:FBgn0053632 Length:180 Species:Drosophila melanogaster


Alignment Length:157 Identity:85/157 - (54%)
Similarity:112/157 - (71%) Gaps:12/157 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 SKFEFTNLQCTSFDKSFDDFEYCYIRSANRSYKYLTLKVNLFKTP------------RFNGYRPF 76
            |..||||:||.:.||.|..|||||::|.||||||::|||.|.|.|            |.|||:||
  Fly    24 SLVEFTNVQCETLDKDFSLFEYCYLQSVNRSYKYVSLKVKLLKIPVTKIKVQFGLYKRLNGYKPF 88

  Fly    77 MFNITLDACRFLKNTDSKPIAKYFYEFFNSYSNLNHSCPFNHDLIVDKIPIDFVNHRVTNILPFP 141
            ::|:|||.|||||:.:..|||.|||..|..|||:||:||:||||::|::....:|:::|.|||||
  Fly    89 LYNMTLDGCRFLKSRNPNPIALYFYNLFKDYSNINHTCPYNHDLVLDEMSYHSINYKLTEILPFP 153

  Fly   142 EGDYLLETHWIAYEIDRAMVKIYYTIS 168
            ||:|.||.|||||:||||:...|:..|
  Fly   154 EGNYKLEVHWIAYDIDRAITTFYFAFS 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33654NP_001027165.1 DUF1091 60..147 CDD:461928 50/98 (51%)
CG33632NP_001036537.1 DUF1091 78..159 CDD:461928 44/80 (55%)

Return to query results.
Submit another query.