DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33654 and CG33632

Sequence 1:NP_001027165.1 Gene:CG33654 FlyBaseID:FBgn0053654 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_001036537.1 Gene:CG33632 FlyBaseID:FBgn0053632 Length:180 Species:Drosophila melanogaster

Alignment Length:157 Identity:85/158 (54%)
Similarity:112/158 (71%) Gaps:12/158 (8%)


  Fly    24 SKFEFTNLQCTSFDKSFDDFEYCYIRSANRSYKYLTLKVNLFKTP------------RFNGYRPF 76
            |..||||:||.:.||.|..|||||::|.||||||::|||.|.|.|            |.|||:||
  Fly    24 SLVEFTNVQCETLDKDFSLFEYCYLQSVNRSYKYVSLKVKLLKIPVTKIKVQFGLYKRLNGYKPF 88

  Fly    77 MFNITLDACRFLKNTDSKPIAKYFYEFFNSYSNLNHSCPFNHDLIVDKIPIDFVNHRVTNILPFP 141
            ::|:|||.|||||:.:..|||.|||..|..|||:||:||:||||::|::....:|:::|.|||||
  Fly    89 LYNMTLDGCRFLKSRNPNPIALYFYNLFKDYSNINHTCPYNHDLVLDEMSYHSINYKLTEILPFP 153

  Fly   142 EGDYLLETHWIAYEIDRAMVKIYYTIS 168
            ||:|.||.|||||:||||:...|:..|
  Fly   154 EGNYKLEVHWIAYDIDRAITTFYFAFS 180

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33654NP_001027165.1 DUF1091 60..147 CDD:284008 50/99 (51%)
CG33632NP_001036537.1 DUF1091 74..159 CDD:284008 44/85 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C286202
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.