DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33654 and CG33721

Sequence 1:NP_001027165.1 Gene:CG33654 FlyBaseID:FBgn0053654 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_001036743.1 Gene:CG33721 FlyBaseID:FBgn0053721 Length:181 Species:Drosophila melanogaster

Alignment Length:180 Identity:67/181 (37%)
Similarity:105/181 (58%) Gaps:16/181 (9%)


  Fly     3 KNTRCHIVVILVILLMAKWASSKFEFTNLQCTSFDKSFDDFEYCYIRSANRSYKYLTLKVNLFKT 67
            |..:..::||....:|..  :||.||||.:|...|.::..||||:|:|.||:|||::||.|:::.
  Fly     4 KAAKLFVLVIFFGNIMEN--ASKLEFTNFKCHVKDPTYLSFEYCFIKSVNRTYKYISLKANMYEV 66

  Fly    68 P------------RFNGYRPFMFNITLDACRFL--KNTDSKPIAKYFYEFFNSYSNLNHSCPFNH 118
            |            ||..|.|.....::|.|:::  |...:.|:.:.|.|....|:|.||.||::|
  Fly    67 PITNASAKLQISRRFRSYMPITIAASIDVCKYMAYKKNLANPMLRLFEEITKKYTNTNHKCPYDH 131

  Fly   119 DLIVDKIPIDFVNHRVTNILPFPEGDYLLETHWIAYEIDRAMVKIYYTIS 168
            |||:|::|..:::...|||||.|.|||...:.|.:..|:||.:.||||:|
  Fly   132 DLIIDRLPSKYLSEHFTNILPLPPGDYSFNSIWYSRNIERATISIYYTVS 181

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33654NP_001027165.1 DUF1091 60..147 CDD:284008 35/101 (35%)
CG33721NP_001036743.1 DUF1091 74..160 CDD:284008 31/86 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.